Recombinant Cynomolgus PLAUR Protein, N-His-tagged

Cat.No. : PLAUR-793C
Product Overview : Recombinant Cynomolgus PLAUR Protein with a N-His tag was expressed in HEK293.
Availability July 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : HEK293
Tag : His
Description : Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form.
Molecular Mass : ~ 33 kDa
AA Sequence : LRCMQCKSNGDCRVEECALGQDLCRTTIVRMWEEGEELELVEKSCTHSEKTNRTMSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTFSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPSCPGSSGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGHQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTYEPKNQSYMVRGCVTASMCQRAHLGDAFSMHHINVSCCTESGCNHPDLDIQYRKGHHHHHHHH
Endotoxin : <1 EU/μg (determined by the LAL method)
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.8 mg/mL
Storage Buffer : PBS buffer
Gene Name PLAUR plasminogen activator, urokinase receptor [ Macaca mulatta (Rhesus monkey) ]
Official Symbol PLAUR
Synonyms PLAUR; plasminogen activator, urokinase receptor; urokinase plasminogen activator surface receptor
Gene ID 710662
mRNA Refseq XM_015124159
Protein Refseq XP_014979645
UniProt ID F6Q0B8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLAUR Products

Required fields are marked with *

My Review for All PLAUR Products

Required fields are marked with *

0
cart-icon