Recombinant Cynomolgus PLAUR Protein, N-His-tagged

• Cat.No.: PLAUR-793C
• Product Overview: Recombinant Cynomolgus PLAUR Protein with a N-His tag was expressed in HEK293.

Specification

• Species: Cynomolgus
• Source: HEK293
• Tag: His
• Description: Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form.
• Molecular Mass: ~ 33 kDa
• AA Sequence: LRCMQCKSNGDCRVEECALGQDLCRTTIVRMWEEGEELELVEKSCTHSEKTNRTMSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTFSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPSCPGSSGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGHQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTYEPKNQSYMVRGCVTASMCQRAHLGDAFSMHHINVSCCTESGCNHPDLDIQYRKGHHHHHHHH
• Endotoxin: <1 EU/μg (determined by the LAL method)
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.8 mg/mL
• Storage Buffer: PBS buffer

Gene Information

• Gene Name: PLAUR plasminogen activator, urokinase receptor [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: PLAUR
• Synonyms: PLAUR; plasminogen activator, urokinase receptor; urokinase plasminogen activator surface receptor
• Gene ID: 710662
• mRNA Refseq: XM_015124159
• Protein Refseq: XP_014979645
• UniProt ID: F6Q0B8