Recombinant Cynomolgus PLAUR Protein, N-His-tagged
| Cat.No. : | PLAUR-793C |
| Product Overview : | Recombinant Cynomolgus PLAUR Protein with a N-His tag was expressed in HEK293. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | HEK293 |
| Tag : | His |
| Description : | Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form. |
| Molecular Mass : | ~ 33 kDa |
| AA Sequence : | LRCMQCKSNGDCRVEECALGQDLCRTTIVRMWEEGEELELVEKSCTHSEKTNRTMSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTFSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPSCPGSSGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGHQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTYEPKNQSYMVRGCVTASMCQRAHLGDAFSMHHINVSCCTESGCNHPDLDIQYRKGHHHHHHHH |
| Endotoxin : | <1 EU/μg (determined by the LAL method) |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.8 mg/mL |
| Storage Buffer : | PBS buffer |
| Gene Name | PLAUR plasminogen activator, urokinase receptor [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | PLAUR |
| Synonyms | PLAUR; plasminogen activator, urokinase receptor; urokinase plasminogen activator surface receptor |
| Gene ID | 710662 |
| mRNA Refseq | XM_015124159 |
| Protein Refseq | XP_014979645 |
| UniProt ID | F6Q0B8 |
| ◆ Recombinant Proteins | ||
| PLAUR-1573H | Recombinant Human PLAUR protein, His-Avi-tagged, Biotinylated | +Inquiry |
| PLAUR-0809H | Recombinant Human PLAUR protein, His-tagged | +Inquiry |
| PLAUR-392H | Active Recombinant Human PLAUR protein, His-tagged | +Inquiry |
| Plaur-831M | Active Recombinant Mouse Plaur protein, His&hFc-tagged | +Inquiry |
| PLAUR-1698H | Recombinant Human PLAUR Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLAUR-1888HCL | Recombinant Human PLAUR cell lysate | +Inquiry |
| PLAUR-2551MCL | Recombinant Mouse PLAUR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAUR Products
Required fields are marked with *
My Review for All PLAUR Products
Required fields are marked with *
