Recombinant Cynomolgus PLAUR Protein, N-His-tagged
Cat.No. : | PLAUR-793C |
Product Overview : | Recombinant Cynomolgus PLAUR Protein with a N-His tag was expressed in HEK293. |
Availability | August 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Tag : | His |
Description : | Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form. |
Molecular Mass : | ~ 33 kDa |
AA Sequence : | LRCMQCKSNGDCRVEECALGQDLCRTTIVRMWEEGEELELVEKSCTHSEKTNRTMSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTFSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPSCPGSSGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGHQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTYEPKNQSYMVRGCVTASMCQRAHLGDAFSMHHINVSCCTESGCNHPDLDIQYRKGHHHHHHHH |
Endotoxin : | <1 EU/μg (determined by the LAL method) |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.8 mg/mL |
Storage Buffer : | PBS buffer |
Gene Name | PLAUR plasminogen activator, urokinase receptor [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | PLAUR |
Synonyms | PLAUR; plasminogen activator, urokinase receptor; urokinase plasminogen activator surface receptor |
Gene ID | 710662 |
mRNA Refseq | XM_015124159 |
Protein Refseq | XP_014979645 |
UniProt ID | F6Q0B8 |
◆ Recombinant Proteins | ||
PLAUR-1566H | Recombinant Human PLAUR protein, His-tagged | +Inquiry |
PLAUR-536C | Recombinant Cynomolgus Monkey PLAUR Protein, His (Fc)-Avi-tagged | +Inquiry |
Plaur-10609M | Recombinant Mouse Plaur Protein, His (Fc)-Avi-tagged | +Inquiry |
PLAUR-1540H | Recombinant Human PLAUR protein, His-tagged | +Inquiry |
Plaur -83M | Recombinant Soluble Mouse uPAR, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAUR-1888HCL | Recombinant Human PLAUR cell lysate | +Inquiry |
PLAUR-2551MCL | Recombinant Mouse PLAUR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAUR Products
Required fields are marked with *
My Review for All PLAUR Products
Required fields are marked with *