Recombinant Cynomolgus Monkey SLC10A1 Protein, His tagged
| Cat.No. : | SLC10A1-921C |
| Product Overview : | Recombinant Cynomolgus Monkey SLC10A1 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Monkey |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-349 aa |
| Description : | The hepatic sodium/bile acid uptake system exhibits broad substrate specificity and transports various non-bile acid organic compounds as well. It is strictly dependent on the extracellular presence of sodium. |
| AASequence : | MEAHNASAPFNFTLPPNFGKRPTDLALSIILVFMLFFVMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFQLNNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYLYTRGIYDGDLKDKVPYGRIILSLVPVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAMFRCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA |
| Molecular Mass : | 39.6 kDa |
| Purity : | ≥ 85% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Lyophilized from PBS, 0.05% Brij78, 6% Trehalose, pH7.4 The volume before lyophilization is 118μl/vial. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene ID | 712925 |
| Gene Name | SLC10A1 solute carrier family 10 member 1 [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | SLC10A1 |
| Synonyms | SLC10A1; solute carrier family 10 member 1; Ntcp; sodium/bile acid cotransporter; solute carrier family 10 (sodium/bile acid cotransporter family), member 1; solute carrier family 10 member a1 |
| mRNA Refseq | XM_001110268 |
| Protein Refseq | XP_001110268 |
| UniProt ID | F6YRK3 |
| Official Symbol 2 | SLC10A1 |
| Gene ID 2 | 712925 |
| Gene Name 2 | SLC10A1 solute carrier family 10 member 1 [ Macaca mulatta (Rhesus monkey) ] |
| mRNA Refseq 2 | XM_001110268 |
| Protein Refseq 2 | XP_001110268 |
| UniProt ID 2 | G7MYJ1 |
| ◆ Recombinant Proteins | ||
| SLC10A1-5077R | Recombinant Rat SLC10A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC10A1-664C | Recombinant Cynomolgus Monkey SLC10A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL18101MF | Recombinant Full Length Mouse Sodium/Bile Acid Cotransporter(Slc10A1) Protein, His-Tagged | +Inquiry |
| SLC10A1-6826HF | Recombinant Full Length Human SLC10A1 Protein | +Inquiry |
| SLC10A1-2019H | Recombinant Human SLC10A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC10A1-1807HCL | Recombinant Human SLC10A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC10A1 Products
Required fields are marked with *
My Review for All SLC10A1 Products
Required fields are marked with *



