Recombinant Full Length Mouse Sodium/Bile Acid Cotransporter(Slc10A1) Protein, His-Tagged
Cat.No. : | RFL18101MF |
Product Overview : | Recombinant Full Length Mouse Sodium/bile acid cotransporter(Slc10a1) Protein (O08705) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MEAHNVSAPFNFSLPPGFGHRATDTALSVILVVMLLLIMLSLGCTMEFSKIKAHFWKPKG VIIAIVAQYGIMPLSAFLLGKVFHLTSIEALAILICGCSPGGNLSNLFTLAMKGDMNLSI VMTTCSSFTALGMMPLLLYIYSKGIYDGDLKDKVPYKGIMLSLVMVLIPCAIGIFLKSKR PHYVPYVLKAGMIITFSLSVAVTVLSVINVGNSIMFVMTPHLLATSSLMPFTGFLMGYIL SALFRLNPSCRRTISMETGFQNVQLCSTILNVTFPPEVIGPLFFFPLLYMIFQLAEGLLF IIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEKGTHNGNNPPTQPGLSPNGLNSGQM AN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Slc10a1 |
Synonyms | Slc10a1; Ntcp; Sodium/bile acid cotransporter; Na(+/bile acid cotransporter; Na(+/taurocholate transport protein; Sodium/taurocholate cotransporting polypeptide; Solute carrier family 10 member 1 |
UniProt ID | O08705 |
◆ Recombinant Proteins | ||
Slc10a1-5902M | Recombinant Mouse Slc10a1 Protein, Myc/DDK-tagged | +Inquiry |
SLC10A1-0094H | Recombinant Human SLC10A1 Protein (M1-A349), eGFP, Strep II, 10×His tagged | +Inquiry |
SLC10A1-664C | Recombinant Cynomolgus Monkey SLC10A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC10A1-680H | Recombinant Human SLC10A1 Protein | +Inquiry |
SLC10A1-413HFL | Recombinant Full Length Human SLC10A1 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
SLC10A1-921C | Recombinant Cynomolgus Monkey SLC10A1 Protein, His tagged | +Inquiry |
SLC10A1-5418R | Recombinant Full Length Rat SLC10A1 Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC10A1-1807HCL | Recombinant Human SLC10A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Slc10a1 Products
Required fields are marked with *
My Review for All Slc10a1 Products
Required fields are marked with *
0
Inquiry Basket