Recombinant Cynomolgus TTR Protein, His-tagged
| Cat.No. : | TTR-01H |
| Product Overview : | Recombinant Cynomolgus TTR Protein with C-terminal His6 fusion tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Macaca Fascicularis |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 133 |
| Description : | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain (By similarity). |
| Form : | Buffered aqueous solution |
| Molecular Mass : | 14.6 kDa |
| AA Sequence : | GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKEHHHHHH |
| Endotoxin : | <1EU/ug by LAL |
| Purity : | >90% by SDS-PAGE |
| Applications : | Antigen for antibody production ELISA |
| Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.32 mg/ml |
| Storage Buffer : | Solution in PBS, pH 7.4 |
| Gene Name | TTR |
| Official Symbol | TTR |
| Synonyms | Transthyretin,Prealbumin |
| Gene ID | 101864775 |
| mRNA Refseq | NM_001261679.1 |
| Protein Refseq | NP_001248608.1 |
| MIM | 176300 |
| UniProt ID | Q8HXW1 |
| ◆ Recombinant Proteins | ||
| TTR-03H | Recombinant Human TTR Protein, 21-147aa, F87M and L110M Mutation, N-His tagged | +Inquiry |
| TTR-11H | Recombinant Human TTR | +Inquiry |
| TTR-6008R | Recombinant Rat TTR Protein, His (Fc)-Avi-tagged | +Inquiry |
| TTR-2922H | Recombinant Human TTR Protein, MYC/DDK-tagged | +Inquiry |
| TTR-1059C | Recombinant Cynomolgus TTR Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| TTR-31108TH | Native Human TTR | +Inquiry |
| TTR-254H | Native Human Prealbumin | +Inquiry |
| TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
| TTR-706H | Native Human Transthyretin | +Inquiry |
| TTR-141S | Native Sheep prealbumin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TTR-2149HCL | Recombinant Human TTR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TTR Products
Required fields are marked with *
My Review for All TTR Products
Required fields are marked with *
