Recombinant Cynomolgus TTR Protein, His-tagged

Cat.No. : TTR-01H
Product Overview : Recombinant Cynomolgus TTR Protein with C-terminal His6 fusion tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Macaca Fascicularis
Source : HEK293
Tag : His
Protein Length : 133
Description : Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain (By similarity).
Form : Buffered aqueous solution
Molecular Mass : 14.6 kDa
AA Sequence : GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKEHHHHHH
Endotoxin : <1EU/ug by LAL
Purity : >90% by SDS-PAGE
Applications : Antigen for antibody production
ELISA
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.32 mg/ml
Storage Buffer : Solution in PBS, pH 7.4
Gene Name TTR
Official Symbol TTR
Synonyms Transthyretin,Prealbumin
Gene ID 101864775
mRNA Refseq NM_001261679.1
Protein Refseq NP_001248608.1
MIM 176300
UniProt ID Q8HXW1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TTR Products

Required fields are marked with *

My Review for All TTR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon