Recombinant Cynomolgus TTR Protein, His-tagged
Cat.No. : | TTR-01H |
Product Overview : | Recombinant Cynomolgus TTR Protein with C-terminal His6 fusion tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca Fascicularis |
Source : | HEK293 |
Tag : | His |
Protein Length : | 133 |
Description : | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain (By similarity). |
Form : | Buffered aqueous solution |
Molecular Mass : | 14.6 kDa |
AA Sequence : | GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKEHHHHHH |
Endotoxin : | <1EU/ug by LAL |
Purity : | >90% by SDS-PAGE |
Applications : | Antigen for antibody production ELISA |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.32 mg/ml |
Storage Buffer : | Solution in PBS, pH 7.4 |
Gene Name | TTR |
Official Symbol | TTR |
Synonyms | Transthyretin,Prealbumin |
Gene ID | 101864775 |
mRNA Refseq | NM_001261679.1 |
Protein Refseq | NP_001248608.1 |
MIM | 176300 |
UniProt ID | Q8HXW1 |
◆ Recombinant Proteins | ||
TTR-1837H | Recombinant Human Transthyretin | +Inquiry |
TTR-5421C | Recombinant Chicken TTR | +Inquiry |
Ttr-3632M | Recombinant Mouse Ttr protein, GST-tagged | +Inquiry |
TTR-128H | Recombinant Human TTR Protein, His-tagged | +Inquiry |
Ttr-3630M | Recombinant Mouse Ttr protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
TTR-254H | Native Human Prealbumin | +Inquiry |
TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
TTR-141S | Native Sheep prealbumin | +Inquiry |
TTR-706H | Native Human Transthyretin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTR-2149HCL | Recombinant Human TTR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TTR Products
Required fields are marked with *
My Review for All TTR Products
Required fields are marked with *