Recombinant Mouse Ttr protein(21-147aa), His-tagged
| Cat.No. : | Ttr-3938M |
| Product Overview : | Recombinant Mouse Ttr protein(P07309)(21-147aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 21-147aa |
| Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 μg/mL can bind Mouse Rbp4, the EC50 is 17.06-26.23 ng/mL. |
| Molecular Mass : | 16.4 kDa |
| Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN |
| Gene Name | Ttr transthyretin [ Mus musculus ] |
| Official Symbol | Ttr |
| Synonyms | TTR; transthyretin; D17860; AA408768; AI787086; prealbumin; MGC107649; |
| Gene ID | 22139 |
| mRNA Refseq | NM_013697 |
| Protein Refseq | NP_038725 |
| ◆ Recombinant Proteins | ||
| TTR-724C | Recombinant Cattle TTR protein, His-tagged | +Inquiry |
| TTR-3771P | Recombinant Pongo pygmaeus abelii TTR protein, His-SUMO-tagged | +Inquiry |
| Ttr-727G | Recombinant Guinea pig Ttr protein, His & T7-tagged | +Inquiry |
| Ttr-3938M | Recombinant Mouse Ttr protein(21-147aa), His-tagged | +Inquiry |
| TTR-01H | Recombinant Cynomolgus TTR Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| TTR-141S | Native Sheep prealbumin | +Inquiry |
| TTR-254H | Native Human Prealbumin | +Inquiry |
| TTR-131H | Native Human Prealbumin protein | +Inquiry |
| TTR-706H | Native Human Transthyretin | +Inquiry |
| TTR-31108TH | Native Human TTR | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TTR-2149HCL | Recombinant Human TTR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ttr Products
Required fields are marked with *
My Review for All Ttr Products
Required fields are marked with *
