Recombinant Mouse Ttr protein(21-147aa), His-tagged
Cat.No. : | Ttr-3938M |
Product Overview : | Recombinant Mouse Ttr protein(P07309)(21-147aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | 21-147aa |
Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 μg/mL can bind Mouse Rbp4, the EC50 is 17.06-26.23 ng/mL. |
Molecular Mass : | 16.4 kDa |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN |
Gene Name | Ttr transthyretin [ Mus musculus ] |
Official Symbol | Ttr |
Synonyms | TTR; transthyretin; D17860; AA408768; AI787086; prealbumin; MGC107649; |
Gene ID | 22139 |
mRNA Refseq | NM_013697 |
Protein Refseq | NP_038725 |
◆ Recombinant Proteins | ||
TTR-6008R | Recombinant Rat TTR Protein, His (Fc)-Avi-tagged | +Inquiry |
TTR-1059C | Recombinant Cynomolgus TTR Protein, His-tagged | +Inquiry |
TTR-1837H | Recombinant Human Transthyretin | +Inquiry |
TTR-01H | Recombinant Cynomolgus TTR Protein, His-tagged | +Inquiry |
TTR-802C | Recombinant Cynomolgus Monkey TTR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
TTR-706H | Native Human Transthyretin | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
TTR-141S | Native Sheep prealbumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTR-2149HCL | Recombinant Human TTR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ttr Products
Required fields are marked with *
My Review for All Ttr Products
Required fields are marked with *