Recombinant Mouse Ttr protein(21-147aa), His-tagged

Cat.No. : Ttr-3938M
Product Overview : Recombinant Mouse Ttr protein(P07309)(21-147aa), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Protein Length : 21-147aa
Form : Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Bio-activity : Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 μg/mL can bind Mouse Rbp4, the EC50 is 17.06-26.23 ng/mL.
Molecular Mass : 16.4 kDa
Endotoxin : Less than 1.0 EU/ug as determined by LAL method.
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Gene Name Ttr transthyretin [ Mus musculus ]
Official Symbol Ttr
Synonyms TTR; transthyretin; D17860; AA408768; AI787086; prealbumin; MGC107649;
Gene ID 22139
mRNA Refseq NM_013697
Protein Refseq NP_038725

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ttr Products

Required fields are marked with *

My Review for All Ttr Products

Required fields are marked with *

0

Inquiry Basket

cartIcon