Recombinant Dog ANGPT2 protein(19-495aa), His-tagged
Cat.No. : | ANGPT2-2938D |
Product Overview : | Recombinant Dog ANGPT2 protein(A0A8J8)(19-495aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | HEK293 |
Tag : | His |
Protein Length : | 19-495aa |
Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Dog ANGPT2 at 2 μg/mL can bind anti-ANGPT2 recombinant antibody, the EC50 is 2.836-4.992 ng/mL. |
Molecular Mass : | 57.2 kDa |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | YNNFRRSMDSIGRRQYQVQHGSCSYTFLLPETDNCRSPGSYVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLIKLENYIQDNMKKEMVEMQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHSLLTMISPSKSPKDTFVAKEEQIIYRDCAEVFKSGLTTNGIYTLTFPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQRTWKEYKVGFGNPSGEHWLGNEFVFQVTNQQPYVLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF |
Gene Name | ANGPT2 angiopoietin 2 [ Canis lupus familiaris ] |
Official Symbol | ANGPT2 |
Synonyms | ANGPT2; angiopoietin 2; angiopoietin-2; ANG-2; |
Gene ID | 607616 |
mRNA Refseq | NM_001048126 |
Protein Refseq | NP_001041591 |
◆ Recombinant Proteins | ||
ANGPT2-315R | Active Recombinant Rabbit ANGPT2 protein, His-tagged | +Inquiry |
ANGPT2-3182H | Active Recombinant Human ANGPT2 protein(Met1-Phe496), His-tagged | +Inquiry |
ANGPT2-2167C | Active Recombinant Cynomolgus/Rhesus ANGPT2 protein, His-tagged | +Inquiry |
Angpt2-5135R | Recombinant Rat Angpt2 protein(19-496aa), His-tagged | +Inquiry |
ANGPT2-388H | Recombinant Human ANGPT2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPT2-2228HCL | Recombinant Human ANGPT2 cell lysate | +Inquiry |
ANGPT2-001MCL | Recombinant Mouse ANGPT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPT2 Products
Required fields are marked with *
My Review for All ANGPT2 Products
Required fields are marked with *
0
Inquiry Basket