Recombinant Dog CCL17 protein(24-99aa), His-tagged
Cat.No. : | CCL17-4930D |
Product Overview : | Recombinant Dog CCL17 protein(Q95N01)(24-99aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | HEK293 |
Tag : | His |
Protein Length : | 24-99aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 10.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES |
Gene Name | CCL17 chemokine (C-C motif) ligand 17 [ Canis lupus familiaris ] |
Official Symbol | CCL17 |
Synonyms | CCL17; chemokine (C-C motif) ligand 17; C-C motif chemokine 17; CC chemokine TARC; small-inducible cytokine A17; thymus and activation-regulated chemokine; TARC; |
Gene ID | 403586 |
mRNA Refseq | NM_001003051 |
Protein Refseq | NP_001003051 |
◆ Recombinant Proteins | ||
Ccl17-832M | Recombinant Mouse Ccl17 Protein | +Inquiry |
CCL17-24H | Recombinant Human CCL17 protein | +Inquiry |
CCL17-508R | Recombinant Rhesus Macaque CCL17 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ccl17-1346R | Recombinant Rat Ccl17 protein | +Inquiry |
CCL17-8818C | Recombinant Cynomolgus CCL17, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL17-588HCL | Recombinant Human CCL17 cell lysate | +Inquiry |
CCL17-001CCL | Recombinant Cynomolgus CCL17 cell lysate | +Inquiry |
CCL17-535MCL | Recombinant Mouse CCL17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL17 Products
Required fields are marked with *
My Review for All CCL17 Products
Required fields are marked with *