Recombinant Dog GHR protein, His&Myc-tagged
Cat.No. : | GHR-453D |
Product Overview : | Recombinant Dog GHR protein(Q9TU69)(19-264aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 19-264aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.5 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | FSGSEATPTILGSASQSLQRVNPGLGTNSSEKPKFTKCRSPELETFSCHWTDGVRHGLKNAGSVQLFYIRRSTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTSNGGTVDQKCFSVEEIVQPDPPIGLNWTLLNISLTGIHADIQVRWEPPPNADVQKGWIVLKYELQYKEVNESQWKMMDPVSATSVPVYSLRLDKEYEVRVRSRQRNSEKYGEFSEALYVTLPQMSPFACEEDFQ |
Gene Name | GHR growth hormone receptor [ Canis lupus familiaris ] |
Official Symbol | GHR |
Synonyms | GHR; growth hormone receptor; GH receptor; somatotropin receptor; |
Gene ID | 403721 |
mRNA Refseq | NM_001003123 |
Protein Refseq | NP_001003123 |
◆ Recombinant Proteins | ||
GHR-2960P | Recombinant Pig GHR protein, His-tagged | +Inquiry |
GHR-1080C | Recombinant Chicken GHR | +Inquiry |
RFL32525HF | Recombinant Full Length Human Growth Hormone Receptor(Ghr) Protein, His-Tagged | +Inquiry |
RFL30766RF | Recombinant Full Length Rat Growth Hormone Receptor(Ghr) Protein, His-Tagged | +Inquiry |
Ghr-5620M | Active Recombinant Mouse Growth Hormone Receptor, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
GHR-42H | Active Recombinant Human GHR Homodimer Protein, His&Avi tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GHR-1140RCL | Recombinant Rat GHR cell lysate | +Inquiry |
GHR-2401MCL | Recombinant Mouse GHR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GHR Products
Required fields are marked with *
My Review for All GHR Products
Required fields are marked with *