Recombinant Dog GHR protein, His&Myc-tagged
| Cat.No. : | GHR-453D |
| Product Overview : | Recombinant Dog GHR protein(Q9TU69)(19-264aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 19-264aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.5 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | FSGSEATPTILGSASQSLQRVNPGLGTNSSEKPKFTKCRSPELETFSCHWTDGVRHGLKNAGSVQLFYIRRSTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTSNGGTVDQKCFSVEEIVQPDPPIGLNWTLLNISLTGIHADIQVRWEPPPNADVQKGWIVLKYELQYKEVNESQWKMMDPVSATSVPVYSLRLDKEYEVRVRSRQRNSEKYGEFSEALYVTLPQMSPFACEEDFQ |
| Gene Name | GHR growth hormone receptor [ Canis lupus familiaris ] |
| Official Symbol | GHR |
| Synonyms | GHR; growth hormone receptor; GH receptor; somatotropin receptor; |
| Gene ID | 403721 |
| mRNA Refseq | NM_001003123 |
| Protein Refseq | NP_001003123 |
| ◆ Recombinant Proteins | ||
| GHR-2959R | Recombinant Rhesus macaque GHR protein, His-tagged | +Inquiry |
| Ghr-5766R | Recombinant Rat Ghr protein, His & T7-tagged | +Inquiry |
| GHR-1836R | Active Recombinant Rabbit GHR Protein | +Inquiry |
| GHR-280H | Recombinant Human GHR Protein, Fc-tagged | +Inquiry |
| RFL32525HF | Recombinant Full Length Human Growth Hormone Receptor(Ghr) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GHR-2401MCL | Recombinant Mouse GHR cell lysate | +Inquiry |
| GHR-1140RCL | Recombinant Rat GHR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GHR Products
Required fields are marked with *
My Review for All GHR Products
Required fields are marked with *
