Recombinant Rhesus macaque GHR protein, His-tagged
Cat.No. : | GHR-2959R |
Product Overview : | Recombinant Rhesus macaque GHR protein(P79194)(19-264aa), fused to C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-264aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.2 kDa |
AA Sequence : | FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLPQMNQFTCEEDFY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
RFL33553BF | Recombinant Full Length Bos Indicus Growth Hormone Receptor(Ghr) Protein, His-Tagged | +Inquiry |
GHR-548R | Recombinant Rat Ghr, Fc tagged | +Inquiry |
Ghr-56M | Recombinant Mouse Ghr Protein, His (Fc)-Avi-tagged | +Inquiry |
GHR-5764H | Recombinant Human GHR protein, His & T7-tagged | +Inquiry |
GHR-1226H | Recombinant Human GHR Protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
GHR-42H | Active Recombinant Human GHR Homodimer Protein, His&Avi tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GHR-1140RCL | Recombinant Rat GHR cell lysate | +Inquiry |
GHR-2401MCL | Recombinant Mouse GHR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GHR Products
Required fields are marked with *
My Review for All GHR Products
Required fields are marked with *