Recombinant Dog GLP1R Protein, His tagged

Cat.No. : GLP1R-01D
Product Overview : Recombinant Dog GLP1R Protein with His tag was expressed in HEK293.
Availability December 24, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : HEK293
Tag : His
Protein Length : 25-145 aa
Description : This gene encodes a 7-transmembrane protein that functions as a receptor for glucagon-like peptide 1 (GLP-1) hormone, which stimulates glucose-induced insulin secretion. This receptor, which functions at the cell surface, becomes internalized in response to GLP-1 and GLP-1 analogs, and it plays an important role in the signaling cascades leading to insulin secretion. It also displays neuroprotective effects in animal models. Polymorphisms in this gene are associated with diabetes. The protein is an important drug target for the treatment of type 2 diabetes and stroke. Alternative splicing of this gene results in multiple transcript variants.
Form : Sterile PBS, pH7.4
Molecular Mass : 15 kDa
AASequence : RPQGATVSLSETVQKWREYRHQCQRFLTETPPPATGLFCNRTFDEYACWPDGLPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLRQHNSSLPWRNLSECEESKRGERSSPEEQLLSFHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.46 mg/mL by BCA
Publications :
Cochinchinenin C, a potential nonpolypeptide anti-diabetic drug, targets a glucagon-like peptide-1 receptor. (2017)
Loureirin B activates GLP-1R and promotes insulin secretion in Ins-1 cells (2020)
Gene Name GLP1R glucagon-like peptide 1 receptor [ Canis lupus familiaris ]
Official Symbol GLP1R
Synonyms GLP1R; glucagon-like peptide 1 receptor
Gene ID 481778
mRNA Refseq XM_038683409
Protein Refseq XP_038539337
UniProt ID A0A8C0MKK3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLP1R Products

Required fields are marked with *

My Review for All GLP1R Products

Required fields are marked with *

0
cart-icon
0
compare icon