Recombinant Dog GLP1R Protein, His tagged

• Cat.No.: GLP1R-01D
• Product Overview: Recombinant Dog GLP1R Protein with His tag was expressed in HEK293.

Specification

• Species: Dog
• Source: HEK293
• Tag: His
• Protein Length: 25-145 aa
• Description: This gene encodes a 7-transmembrane protein that functions as a receptor for glucagon-like peptide 1 (GLP-1) hormone, which stimulates glucose-induced insulin secretion. This receptor, which functions at the cell surface, becomes internalized in response to GLP-1 and GLP-1 analogs, and it plays an important role in the signaling cascades leading to insulin secretion. It also displays neuroprotective effects in animal models. Polymorphisms in this gene are associated with diabetes. The protein is an important drug target for the treatment of type 2 diabetes and stroke. Alternative splicing of this gene results in multiple transcript variants.
• Form: Sterile PBS, pH7.4
• Molecular Mass: 15 kDa
• AASequence: RPQGATVSLSETVQKWREYRHQCQRFLTETPPPATGLFCNRTFDEYACWPDGLPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLRQHNSSLPWRNLSECEESKRGERSSPEEQLLSFHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.46 mg/mL by BCA
• Publications:
  Cochinchinenin C, a potential nonpolypeptide anti-diabetic drug, targets a glucagon-like peptide-1 receptor. (2017)
  Loureirin B activates GLP-1R and promotes insulin secretion in Ins-1 cells (2020)

Gene Information

• Gene Name: GLP1R glucagon-like peptide 1 receptor [ Canis lupus familiaris ]
• Official Symbol: GLP1R
• Synonyms: GLP1R; glucagon-like peptide 1 receptor
• Gene ID: 481778
• mRNA Refseq: XM_038683409
• Protein Refseq: XP_038539337
• UniProt ID: A0A8C0MKK3