Recombinant Rat Glp1r protein, His/SUMO-tagged
| Cat.No. : | GLP1R-2565R |
| Product Overview : | Recombinant Rat Glp1r(22-463 aa) fused with His/SUMO tag at was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 22-463 aa |
| Description : | Glp1r played an important role in many functions. |
| Form : | Tris-based buffer,50% glycerol |
| AA Sequence : | GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERNSPEEQLLSLYIIYTVGYALSFSALVIASAILVSFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLGCRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFSVFSEQRIFKLYLSIGWGVPLLFVIPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLVFIRVICIVIAKLKANLMCKTDIKCRLAKSTLTLIPLLGTHEVIFAFVMDEHARGTLRFVKLFTELSFTSFQGFMVAVLYCFVNNEVQMEFRKSWERWRLERLNIQRDSSMKPLKCPTSSVSSGATVGSSVYAATCQNSCS |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. |
| Gene Name | Glp1r glucagon-like peptide 1 receptor [ Rattus norvegicus ] |
| Official Symbol | Glp1r |
| Synonyms | GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; pancreatic beta cell receptor for the gluco-incretin hormone glucagon-like peptide 1; Glip; RATGL1RCP; |
| Gene ID | 25051 |
| mRNA Refseq | NM_012728 |
| Protein Refseq | NP_036860 |
| UniProt ID | P32301 |
| Chromosome Location | 20p12 |
| Pathway | Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class B Secretin-like, organism-specific biosystem; Glucagon-type ligand receptors, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; |
| Function | G-protein coupled peptide receptor activity; G-protein coupled peptide receptor activity; G-protein coupled receptor activity; glucagon receptor activity; peptide hormone binding; peptide receptor activity; receptor activity; signal transducer activity; |
| ◆ Recombinant Proteins | ||
| RFL23764HF | Recombinant Full Length Human Glucagon-Like Peptide 1 Receptor(Glp1R) Protein, His-Tagged | +Inquiry |
| GLP1R-2755H | Recombinant Human GLP1R Protein, His-tagged | +Inquiry |
| GLP1R-6744H | Recombinant Human GLP1R protein, His-tagged | +Inquiry |
| GLP1R-1933H | Active Recombinant Human GLP1R Full Length Transmembrane protein, Strep&Flag-tagged(VLP) | +Inquiry |
| GLP1R-2205H | Recombinant Human GLP1R Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| GLP1R-549C | Recombinant Cynomolgus GLP1R Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Glp1r Products
Required fields are marked with *
My Review for All Glp1r Products
Required fields are marked with *



