Recombinant Rat Glp1r protein, His/SUMO-tagged

Cat.No. : GLP1R-2565R
Product Overview : Recombinant Rat Glp1r(22-463 aa) fused with His/SUMO tag at was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His&SUMO
Protein Length : 22-463 aa
Description : Glp1r played an important role in many functions.
Form : Tris-based buffer,50% glycerol
AA Sequence : GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERNSPEEQLLSLYIIYTVGYALSFSALVIASAILVSFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLGCRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFSVFSEQRIFKLYLSIGWGVPLLFVIPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLVFIRVICIVIAKLKANLMCKTDIKCRLAKSTLTLIPLLGTHEVIFAFVMDEHARGTLRFVKLFTELSFTSFQGFMVAVLYCFVNNEVQMEFRKSWERWRLERLNIQRDSSMKPLKCPTSSVSSGATVGSSVYAATCQNSCS
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade.
Gene Name Glp1r glucagon-like peptide 1 receptor [ Rattus norvegicus ]
Official Symbol Glp1r
Synonyms GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; pancreatic beta cell receptor for the gluco-incretin hormone glucagon-like peptide 1; Glip; RATGL1RCP;
Gene ID 25051
mRNA Refseq NM_012728
Protein Refseq NP_036860
UniProt ID P32301
Chromosome Location 20p12
Pathway Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class B Secretin-like, organism-specific biosystem; Glucagon-type ligand receptors, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem;
Function G-protein coupled peptide receptor activity; G-protein coupled peptide receptor activity; G-protein coupled receptor activity; glucagon receptor activity; peptide hormone binding; peptide receptor activity; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Glp1r Products

Required fields are marked with *

My Review for All Glp1r Products

Required fields are marked with *

0
cart-icon