Recombinant Dog IL18 Protein, Tag Free

• Cat.No.: IL18-01D
• Product Overview: Recombinant Dog IL18 Protein (37-193 aa) without tag was expressed in E. coli.

Specification

• Species: Dog
• Source: E.coli
• Tag: Non
• Protein Length: 37-193 aa
• Description: Pro-inflammatory cytokine primarily involved in epithelial barrier repair, polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells and natural killer (NK) cells. Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore.
• AASequence: MYFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS
• Molecular Mass: 18 kDa
• Endotoxin: < 1 EU/μg of protein determined by LAL method
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile 50mM Tris, pH8.0, 300mM NaCl, 0.1% SKL
• Concentration: 0.31 mg/mL by BCA

Gene Information

• Gene Name: IL18 interleukin 18 [ Canis lupus familiaris (dog) ]
• Official Symbol: IL18
• Synonyms: IL18; interleukin 18; IGIF; interleukin-18; IFN-gamma-inducing factor; IL-1 gamma; IL-18; interferon gamma-inducing factor; interleukin 18 (interferon-gamma-inducing factor); interleukin-1 gamma
• Gene ID: 403796
• mRNA Refseq: NM_001003169
• Protein Refseq: NP_001003169
• UniProt ID: Q9XSR0

Q&As

What are the difference between IL18-01HG, IL18-153HG and IL18-500H. (sequence, biological activity, QC, or what do you propose to buy)

IL18-01HG: Sequence: a.a.37-193 Endotoxin: <20 EU/mg Bio-activity: >5.0 x 10^4 IU/mg QC: Activity test, SDS-PAGE, LAL, SEC-HPLC IL18-153HG: Protein length: Tyr37-Asp193 AA Sequence: YFGKLESKLS VIRNLNDQVL FIDQGNRPLF EDMTDSDCRD NAPRTIFIISMYKDSQPRGM AVTISVKCEK ISTLSCENKI ISFKEMNPPD NIKDTKSDIIFFQRSVPGHD NKMQFESSSY EGYFLACEKE RDLFKLILKK EDELGDRSIMFTVQNEDVD Bio-activity: 1.0*10^6IU Measured by its ability to induce IFN-gamma secretion by KG‐1 human acute myelogenous leukemia cells in the presence of TNF-alpha. QC: Activity test, SDS-PAGE, LAL IL18-500H Recombinant Human IL18 will be custom produced upon order. All the sequence, purity, activity, and QC procedures will be optional and decided by our customer.