Recombinant Dog IL18 Protein, Tag Free
Cat.No. : | IL18-01D |
Product Overview : | Recombinant Dog IL18 Protein (37-193 aa) without tag was expressed in E. coli. |
Availability | October 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | Non |
Protein Length : | 37-193 aa |
Description : | Pro-inflammatory cytokine primarily involved in epithelial barrier repair, polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells and natural killer (NK) cells. Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore. |
AASequence : | MYFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS |
Molecular Mass : | 18 kDa |
Endotoxin : | < 1 EU/μg of protein determined by LAL method |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile 50mM Tris, pH8.0, 300mM NaCl, 0.1% SKL |
Concentration : | 0.31 mg/mL by BCA |
Gene Name | IL18 interleukin 18 [ Canis lupus familiaris (dog) ] |
Official Symbol | IL18 |
Synonyms | IL18; interleukin 18; IGIF; interleukin-18; IFN-gamma-inducing factor; IL-1 gamma; IL-18; interferon gamma-inducing factor; interleukin 18 (interferon-gamma-inducing factor); interleukin-1 gamma |
Gene ID | 403796 |
mRNA Refseq | NM_001003169 |
Protein Refseq | NP_001003169 |
UniProt ID | Q9XSR0 |
◆ Recombinant Proteins | ||
Il18-1013M | Recombinant Mouse Il18 Protein, His-tagged | +Inquiry |
Il18-3094M | Recombinant Mouse Il18 protein, His-tagged | +Inquiry |
IL18-334R | Recombinant Rhesus IL18 protein, His-tagged | +Inquiry |
IL18-3681H | Recombinant Human IL18 protein(Met1-Asp193), GST-tagged | +Inquiry |
IL18-547H | Active Recombinant Human IL18, HIgG1 Fc-tagged, mutant | +Inquiry |
◆ Native Proteins | ||
IL18-01D | Recombinant Dog IL18 Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL18-344HCL | Recombinant Human IL18 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All IL18 Products
Required fields are marked with *
My Review for All IL18 Products
Required fields are marked with *