Recombinant Dog Interleukin-18

Cat.No. : IL18-01D
Availability June 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : E.coli
Tag : Non
Form : 20 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, 5% Trehalose, pH7.4.
Molecular Mass : ~18kDa
AA Sequence : YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLS CKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIM FTVQNKS
Purity : >95% as determined by SDS-PAGE
Storage : Short Term Storage +4°C, Long Term Storage -20°C. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
Reconstitution : It is recommended to reconstitute the lyophilized Dog IL18 in sterile and pre-cooled ddH2O not less than 0.1mg/ml, which can then be further diluted to other aqueous solutions.
Gene Name IL18 interleukin 18 (interferon-gamma-inducing factor) [ Canis lupus familiaris ]
Official Symbol il18
Synonyms IL18; interleukin 18 (interferon-gamma-inducing factor); interleukin-18; IL-18; IL-1 gamma; interleukin-1 gamma; IFN-gamma-inducing factor; interferon gamma inducing factor; interferon gamma-inducing factor; interferon-gamma-inducing factor; IGIF;
Gene ID 403796
mRNA Refseq NM_001003169
Protein Refseq NP_001003169
Pathway African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Influenza A, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (1)

Customer Reviews

Write a review

Q&As

Ask a question

What are the difference between IL18-01HG, IL18-153HG and IL18-500H. (sequence, biological activity, QC, or what do you propose to buy) 04/26/2023

IL18-01HG: Sequence: a.a.37-193 Endotoxin: <20 EU/mg Bio-activity: >5.0 x 10^4 IU/mg QC: Activity test, SDS-PAGE, LAL, SEC-HPLC IL18-153HG: Protein length: Tyr37-Asp193 AA Sequence: YFGKLESKLS VIRNLNDQVL FIDQGNRPLF EDMTDSDCRD NAPRTIFIISMYKDSQPRGM AVTISVKCEK ISTLSCENKI ISFKEMNPPD NIKDTKSDIIFFQRSVPGHD NKMQFESSSY EGYFLACEKE RDLFKLILKK EDELGDRSIMFTVQNEDVD Bio-activity: 1.0*10^6IU Measured by its ability to induce IFN-gamma secretion by KG‐1 human acute myelogenous leukemia cells in the presence of TNF-alpha. QC: Activity test, SDS-PAGE, LAL IL18-500H Recombinant Human IL18 will be custom produced upon order. All the sequence, purity, activity, and QC procedures will be optional and decided by our customer.

Ask a Question for All il18 Products

Required fields are marked with *

My Review for All il18 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon