Recombinant Full Length Human IL18 Protein, C-Flag-tagged

Cat.No. : IL18-1668HFL
Product Overview : Recombinant Full Length Human IL18 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The protein encoded by this gene is a proinflammatory cytokine of the IL-1 family that is constitutively found as a precursor within the cytoplasm of a variety of cells including macrophages and keratinocytes. The inactive IL-18 precursor is processed to its active form by caspase-1, and is capable of stimulating interferon gamma production, and of regulating both T helper (Th) 1 and Th2 responses. This cytokine has been implicated in the injury of different organs, and in potentially fatal conditions characterized by a cytokine storm. In humans, IL-18 gene is located on chromosome 11. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 22.1 kDa
AA Sequence : MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMT DSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQR
SVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Secreted Protein
Protein Pathways : Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway
Full Length : Full L.
Gene Name IL18 interleukin 18 [ Homo sapiens (human) ]
Official Symbol IL18
Synonyms IGIF; IL-18; IL-1g; IL1F4
Gene ID 3606
mRNA Refseq NM_001562.4
Protein Refseq NP_001553.1
MIM 600953
UniProt ID Q14116

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (1)

Customer Reviews

Write a review

Q&As

Ask a question

What are the difference between IL18-01HG, IL18-153HG and IL18-500H. (sequence, biological activity, QC, or what do you propose to buy) 04/26/2023

IL18-01HG: Sequence: a.a.37-193 Endotoxin: <20 EU/mg Bio-activity: >5.0 x 10^4 IU/mg QC: Activity test, SDS-PAGE, LAL, SEC-HPLC IL18-153HG: Protein length: Tyr37-Asp193 AA Sequence: YFGKLESKLS VIRNLNDQVL FIDQGNRPLF EDMTDSDCRD NAPRTIFIISMYKDSQPRGM AVTISVKCEK ISTLSCENKI ISFKEMNPPD NIKDTKSDIIFFQRSVPGHD NKMQFESSSY EGYFLACEKE RDLFKLILKK EDELGDRSIMFTVQNEDVD Bio-activity: 1.0*10^6IU Measured by its ability to induce IFN-gamma secretion by KG‐1 human acute myelogenous leukemia cells in the presence of TNF-alpha. QC: Activity test, SDS-PAGE, LAL IL18-500H Recombinant Human IL18 will be custom produced upon order. All the sequence, purity, activity, and QC procedures will be optional and decided by our customer.

Ask a Question for All IL18 Products

Required fields are marked with *

My Review for All IL18 Products

Required fields are marked with *

0
cart-icon
0
compare icon