Recombinant Dog PLA2G15 protein, His&Myc-tagged
Cat.No. : | PLA2G15-4471D |
Product Overview : | Recombinant Dog PLA2G15 protein(Q6XPZ3)(32-408aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 32-408aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 46.8 kDa |
AA Sequence : | RRPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKRTESYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVDWGYIRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKNKYIQAFVALGAPWGGVAKTLRVLASGDNNRIPVIRPLKIREQQRSAVSTSWLLPYNYTWSPEKIFVHTPTANYTLRDYHQFFQDIGFKDGWLMRQDTEGLVEAMVPPGVPLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLQSALQCQAWRGHQEHQVSLQALPGSEHIEMLANATTLAYLKRVLLGP |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | PLA2G15 phospholipase A2, group XV [ Canis lupus familiaris ] |
Official Symbol | PLA2G15 |
Synonyms | PLA2G15; phospholipase A2, group XV; group XV phospholipase A2; 1-O-acylceramide synthase; lysosomal phospholipase A2; LCAT-like lysophospholipase; lysophospholipase 3 (lysosomal phospholipase A2); ACS; LLPL; LPLA2; LYPLA3; |
Gene ID | 403403 |
mRNA Refseq | NM_001002940 |
Protein Refseq | NP_001002940 |
◆ Recombinant Proteins | ||
PLA2G15-4485R | Recombinant Rat PLA2G15 Protein | +Inquiry |
Pla2g15-434R | Recombinant Rat Pla2g15 protein, His&Myc-tagged | +Inquiry |
PLA2G15-2522M | Recombinant Mouse PLA2G15 Protein (34-412 aa), His-Myc-tagged | +Inquiry |
Pla2g15-1945M | Recombinant Mouse Pla2g15 Protein, His-tagged | +Inquiry |
PLA2G15-6243HF | Recombinant Full Length Human PLA2G15 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G15-3144HCL | Recombinant Human PLA2G15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLA2G15 Products
Required fields are marked with *
My Review for All PLA2G15 Products
Required fields are marked with *
0
Inquiry Basket