Recombinant Dog PLA2G15 protein, His&Myc-tagged

• Cat.No.: PLA2G15-4471D
• Product Overview: Recombinant Dog PLA2G15 protein(Q6XPZ3)(32-408aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect cell.

Specification

• Species: Dog
• Source: Insect Cells
• Tag: His&Myc
• Protein Length: 32-408aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 46.8 kDa
• AA Sequence: RRPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKRTESYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVDWGYIRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKNKYIQAFVALGAPWGGVAKTLRVLASGDNNRIPVIRPLKIREQQRSAVSTSWLLPYNYTWSPEKIFVHTPTANYTLRDYHQFFQDIGFKDGWLMRQDTEGLVEAMVPPGVPLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLQSALQCQAWRGHQEHQVSLQALPGSEHIEMLANATTLAYLKRVLLGP
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: PLA2G15 phospholipase A2, group XV [ Canis lupus familiaris ]
• Official Symbol: PLA2G15
• Synonyms: PLA2G15; phospholipase A2, group XV; group XV phospholipase A2; 1-O-acylceramide synthase; lysosomal phospholipase A2; LCAT-like lysophospholipase; lysophospholipase 3 (lysosomal phospholipase A2); ACS; LLPL; LPLA2; LYPLA3
• Gene ID: 403403
• mRNA Refseq: NM_001002940
• Protein Refseq: NP_001002940