Recombinant Dog TJP1 Protein (1633-1769 aa), His-tagged
Cat.No. : | TJP1-833D |
Product Overview : | Recombinant Dog TJP1 Protein (1633-1769 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | 1633-1769 aa |
Description : | The N-terminal may be involved in transducing a signal required for tight junction assbly, while the C-terminal may have specific properties of tight junctions. The alpha domain might be involved in stabilizing junctions. Plays a role in the regulation of cell migration by targeting CDC42BPB to the leading edge of migrating cells. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 18.7 kDa |
AA Sequence : | VVATARGVFNNNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGANCVSVLIDHF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | TJP1 tight junction protein 1 (zona occludens 1) [ Canis lupus familiaris ] |
Official Symbol | TJP1 |
Synonyms | TJP1; zonula occludens 1; ZO1; ZO-1; |
Gene ID | 403752 |
mRNA Refseq | NM_001003140 |
Protein Refseq | NP_001003140 |
UniProt ID | O97758 |
◆ Recombinant Proteins | ||
TJP1-833D | Recombinant Dog TJP1 Protein (1633-1769 aa), His-tagged | +Inquiry |
TJP1-464H | Recombinant Human TJP1 Protein, His-tagged | +Inquiry |
TJP1-3189H | Recombinant Human TJP1 Protein (Met1-Val190), His tagged | +Inquiry |
Tjp1-6440M | Recombinant Mouse Tjp1 Protein, Myc/DDK-tagged | +Inquiry |
TJP1-239H | Recombinant Human Tight Junction Protein 1 (Zona Occludens 1) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TJP1 Products
Required fields are marked with *
My Review for All TJP1 Products
Required fields are marked with *
0
Inquiry Basket