Recombinant Dog TJP1 Protein (1633-1769 aa), His-tagged

Cat.No. : TJP1-833D
Product Overview : Recombinant Dog TJP1 Protein (1633-1769 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : E.coli
Tag : His
Protein Length : 1633-1769 aa
Description : The N-terminal may be involved in transducing a signal required for tight junction assbly, while the C-terminal may have specific properties of tight junctions. The alpha domain might be involved in stabilizing junctions. Plays a role in the regulation of cell migration by targeting CDC42BPB to the leading edge of migrating cells.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 18.7 kDa
AA Sequence : VVATARGVFNNNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGANCVSVLIDHF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name TJP1 tight junction protein 1 (zona occludens 1) [ Canis lupus familiaris ]
Official Symbol TJP1
Synonyms TJP1; zonula occludens 1; ZO1; ZO-1;
Gene ID 403752
mRNA Refseq NM_001003140
Protein Refseq NP_001003140
UniProt ID O97758

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TJP1 Products

Required fields are marked with *

My Review for All TJP1 Products

Required fields are marked with *

0
cart-icon