Recombinant E.coli Mug, His-tagged
Cat.No. : | mug-93E |
Product Overview : | Recombinant E. coli G/U Mismatch-Specific DNA Glycosylase/Mug is produced with our E.coli expression system. The target protein is expressed with sequence (Met1-Arg168) of E.coli Mug. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-168 a.a. |
Description : | E. coli Mismatch Uracil DNA Glycosylase (Mug protein), also known as G/U mismatch-specific DNA glycosylase, is an 18 kDa constitutively expressed protein which belongs to the TDG/mug DNA glycosylase family. It has been proposed that the Mug protein excises 3,N4-ethenocytosine and removes the uracil base from mismatches in the order of U:G>U:A, although the biological role remains unclear. Uracil bases in DNA can arise from deamination of cytosine giving rise to increased spontaneous mutations. The enzyme Uracil-N-Glycosylase removes uracil from the DNA leaving an AP site. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and the mispaired base. The complementary strand guanine functions in substrate recognition. Required for DNA damage lesion repair in stationary-phase cells. |
Form : | Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 2.5mM β-ME, 1mM PMSF, 50% Glycerol, pH 8.0 |
AA Sequence : | MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPANRFWKVIYQAGFTDRQLKPQEAQHLLDYRCG VTKLVDRPTVQANEVSKQELHAGGRKLIEKIEDYQPQALAILGKQAYEQGFSQRGAQWGKQTLTI GSTQIWVLPNPSGLSRVSLEKLVEAYRELDQALVVRGRLEHHHHHH |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at < -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All mug Products
Required fields are marked with *
My Review for All mug Products
Required fields are marked with *