Recombinant E. coli mug Protein, His-tagged

Cat.No. : mug-01E
Product Overview : Recombinant E. coli mug protein(1-168), fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His
Protein Length : 1-168
Description : Excises ethenocytosine and uracil, which can arise by alkylation or deamination of cytosine, respectively, from the corresponding mispairs with guanine in ds-DNA. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and the mispaired base. The complementary strand guanine functions in substrate recognition. Required for DNA damage lesion repair in stationary-phase cells.
Molecular Mass : 21.1 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPANRFWKVIYQAGFTDRQLKPQEAQHLLDYRCGVTKLVDRPTVQANEVSKQELHAGGRKLIEKIEDYQPQALAILGKQAYEQGFSQRGAQWGKQTLTIGSTQIWVLPNPSGLSRVSLEKLVEAYRELDQALVVRGR
Purity : >90% by SDS-PAGE
Stability : Shelf life: one year from despatch
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Storage Buffer : Presentation State: Purified
State: Liquid purified protein
Buffer System: 20 mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 20% glycerol
Gene Name mug stationary phase mismatch/uracil DNA glycosylase [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol mug
Synonyms mug; stationary phase mismatch/uracil DNA glycosylase; ECK3058; ygjF; stationary phase mismatch/uracil DNA glycosylase; EC 3.2.2.28
Gene ID 947560
Protein Refseq NP_417540
UniProt ID P0A9H1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All mug Products

Required fields are marked with *

My Review for All mug Products

Required fields are marked with *

0

Inquiry Basket

cartIcon