Recombinant E. coli mug Protein, His-tagged

• Cat.No.: mug-01E
• Product Overview: Recombinant E. coli mug protein(1-168), fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His
• Protein Length: 1-168
• Description: Excises ethenocytosine and uracil, which can arise by alkylation or deamination of cytosine, respectively, from the corresponding mispairs with guanine in ds-DNA. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and the mispaired base. The complementary strand guanine functions in substrate recognition. Required for DNA damage lesion repair in stationary-phase cells.
• Molecular Mass: 21.1 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPANRFWKVIYQAGFTDRQLKPQEAQHLLDYRCGVTKLVDRPTVQANEVSKQELHAGGRKLIEKIEDYQPQALAILGKQAYEQGFSQRGAQWGKQTLTIGSTQIWVLPNPSGLSRVSLEKLVEAYRELDQALVVRGR
• Purity: >90% by SDS-PAGE
• Stability: Shelf life: one year from despatch
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Storage Buffer: Presentation State: Purified
  State: Liquid purified protein
  Buffer System: 20 mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 20% glycerol

Gene Information

• Gene Name: mug stationary phase mismatch/uracil DNA glycosylase [ Escherichia coli str. K-12 substr. MG1655 ]
• Official Symbol: mug
• Synonyms: mug; stationary phase mismatch/uracil DNA glycosylase; ECK3058; ygjF; stationary phase mismatch/uracil DNA glycosylase; EC 3.2.2.28
• Gene ID: 947560
• Protein Refseq: NP_417540
• UniProt ID: P0A9H1