Recombinant Escherichia coli LEPB Protein (78-324 aa), His-SUMO-tagged

Cat.No. : LEPB-1796E
Product Overview : Recombinant Escherichia coli (strain K12) LEPB Protein (78-324 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Microbiology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His&SUMO
Protein Length : 78-324 aa
Description : Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 43.7 kDa
AA Sequence : RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGLRLSRIGGIH
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name lepB signal peptidase I [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol LEPB
Synonyms ECK2566; lep;
Gene ID 947040
Protein Refseq NP_417063
UniProt ID P00803

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LEPB Products

Required fields are marked with *

My Review for All LEPB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon