Recombinant Escherichia coli LEPB Protein (78-324 aa), His-SUMO-tagged

• Cat.No.: LEPB-1796E
• Product Overview: Recombinant Escherichia coli (strain K12) LEPB Protein (78-324 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Microbiology. Protein Description: Partial.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 78-324 aa
• Description: Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 43.7 kDa
• AA Sequence: RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGLRLSRIGGIH
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: lepB signal peptidase I [ Escherichia coli str. K-12 substr. MG1655 ]
• Official Symbol: LEPB
• Synonyms: ECK2566; lep
• Gene ID: 947040
• Protein Refseq: NP_417063
• UniProt ID: P00803