Recombinant Mycobacterium Tuberculosis LEPB Protein (88-294 aa), His-tagged
Cat.No. : | LEPB-1649M |
Product Overview : | Recombinant Mycobacterium Tuberculosis (strain ATCC 25618/H37Rv) LEPB Protein (88-294 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Tuberculosis |
Source : | Yeast |
Tag : | His |
Protein Length : | 88-294 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.6 kDa |
AA Sequence : | RPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | lepB signal peptidase [ Mycobacterium tuberculosis H37Rv ] |
Official Symbol | LEPB |
Synonyms | lepB; Leader peptidase I; |
Gene ID | 887157 |
Protein Refseq | NP_217419 |
UniProt ID | P9WKA1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEPB Products
Required fields are marked with *
My Review for All LEPB Products
Required fields are marked with *