Recombinant Mycobacterium Tuberculosis LEPB Protein (88-294 aa), His-tagged

Cat.No. : LEPB-1649M
Product Overview : Recombinant Mycobacterium Tuberculosis (strain ATCC 25618/H37Rv) LEPB Protein (88-294 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mycobacterium Tuberculosis
Source : Yeast
Tag : His
Protein Length : 88-294 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 24.6 kDa
AA Sequence : RPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name lepB signal peptidase [ Mycobacterium tuberculosis H37Rv ]
Official Symbol LEPB
Synonyms lepB; Leader peptidase I;
Gene ID 887157
Protein Refseq NP_217419
UniProt ID P9WKA1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LEPB Products

Required fields are marked with *

My Review for All LEPB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon