Recombinant Escherichia coli ruvC protein, His-SUMO-tagged
| Cat.No. : | ruvC-4233E |
| Product Overview : | Recombinant Escherichia coli ruvC protein(P0A814)(2-173aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-173aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 34.6 kDa |
| AA Sequence : | AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| RUVC-1336S | Recombinant Streptomyces coelicolor A3(2) RUVC protein, His-tagged | +Inquiry |
| ruvC-4233E | Recombinant Escherichia coli ruvC protein, His-SUMO-tagged | +Inquiry |
| ruvC-133E | Recombinant E. coli RuvC | +Inquiry |
| RuvC-2666E | Recombinant E. coli Holliday Junction DNA Helicase RuvC | +Inquiry |
| RUVC-2517A | Recombinant Akkermansia Muciniphila RUVC Protein (1-167 aa), His-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ruvC Products
Required fields are marked with *
My Review for All ruvC Products
Required fields are marked with *




