Recombinant Akkermansia Muciniphila RUVC Protein (1-167 aa), His-Myc-tagged

Cat.No. : RUVC-2517A
Product Overview : Recombinant Akkermansia Muciniphila (strain ATCC BAA-835/Muc) RUVC Protein (1-167 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Akkermansia Muciniphila
Source : E.coli
Tag : His&Myc
Protein Length : 1-167 aa
Description : Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 23.2 kDa
AA Sequence : MRILAIDPAIRNTGYAVVEGDYRRARALDYGTLSIPRSVSQSGCLLAIKQHLGNLIDKWNPDEMAVERIIYVQSHQTAITMGAAKAAVVIAAAEAGLRIMEYSPKSVKLSVVGRGAAQKTQVAFMVRALLELRETPESDAADALAIGLTHLFSADPLKAHMMERKYI
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name ruvC crossover junction endodeoxyribonuclease RuvC [ Akkermansia muciniphila ATCC BAA-835 ]
Official Symbol RUVC
Synonyms ruvC;
Gene ID 34175933
Protein Refseq WP_012421048
UniProt ID B2UP63

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RUVC Products

Required fields are marked with *

My Review for All RUVC Products

Required fields are marked with *

0
cart-icon
0
compare icon