Recombinant Akkermansia Muciniphila RUVC Protein (1-167 aa), His-Myc-tagged
Cat.No. : | RUVC-2517A |
Product Overview : | Recombinant Akkermansia Muciniphila (strain ATCC BAA-835/Muc) RUVC Protein (1-167 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Akkermansia Muciniphila |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-167 aa |
Description : | Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 23.2 kDa |
AA Sequence : | MRILAIDPAIRNTGYAVVEGDYRRARALDYGTLSIPRSVSQSGCLLAIKQHLGNLIDKWNPDEMAVERIIYVQSHQTAITMGAAKAAVVIAAAEAGLRIMEYSPKSVKLSVVGRGAAQKTQVAFMVRALLELRETPESDAADALAIGLTHLFSADPLKAHMMERKYI |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | ruvC crossover junction endodeoxyribonuclease RuvC [ Akkermansia muciniphila ATCC BAA-835 ] |
Official Symbol | RUVC |
Synonyms | ruvC; |
Gene ID | 34175933 |
Protein Refseq | WP_012421048 |
UniProt ID | B2UP63 |
◆ Recombinant Proteins | ||
RUVC-1336S | Recombinant Streptomyces coelicolor A3(2) RUVC protein, His-tagged | +Inquiry |
ruvC-133E | Recombinant E. coli RuvC | +Inquiry |
ruvC-4233E | Recombinant Escherichia coli ruvC protein, His-SUMO-tagged | +Inquiry |
RuvC-2666E | Recombinant E. coli Holliday Junction DNA Helicase RuvC | +Inquiry |
RUVC-2517A | Recombinant Akkermansia Muciniphila RUVC Protein (1-167 aa), His-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RUVC Products
Required fields are marked with *
My Review for All RUVC Products
Required fields are marked with *
0
Inquiry Basket