Recombinant Fruit Fly RPL10 Protein (1-218 aa), His-tagged

Cat.No. : RPL10-2590F
Product Overview : Recombinant Fruit Fly (Drosophila melanogaster) RPL10 Protein (1-218 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Fruit Fly
Source : E.coli
Tag : His
Protein Length : 1-218 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 29.5 kDa
AA Sequence : MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGCNVKYRPEHGPIAAWEKAQRDVYA
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name RpL10 Ribosomal protein L10 [ Drosophila melanogaster (fruit fly) ]
Official Symbol RPL10
Synonyms RpL10; anon-EST:Posey179; BcDNA:LD24589; CG17521; Dmel\CG17521; DQM; L10; qm; Qm; Rp L10;
Gene ID 43864
mRNA Refseq NM_001275304
Protein Refseq NP_001262233
UniProt ID O61231

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPL10 Products

Required fields are marked with *

My Review for All RPL10 Products

Required fields are marked with *

0
cart-icon