Recombinant Fruit Fly RPL10 Protein (1-218 aa), His-tagged
| Cat.No. : | RPL10-2590F |
| Product Overview : | Recombinant Fruit Fly (Drosophila melanogaster) RPL10 Protein (1-218 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Fruit Fly |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-218 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 29.5 kDa |
| AA Sequence : | MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGCNVKYRPEHGPIAAWEKAQRDVYA |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | RpL10 Ribosomal protein L10 [ Drosophila melanogaster (fruit fly) ] |
| Official Symbol | RPL10 |
| Synonyms | RpL10; anon-EST:Posey179; BcDNA:LD24589; CG17521; Dmel\CG17521; DQM; L10; qm; Qm; Rp L10; |
| Gene ID | 43864 |
| mRNA Refseq | NM_001275304 |
| Protein Refseq | NP_001262233 |
| UniProt ID | O61231 |
| ◆ Recombinant Proteins | ||
| RPL10-14403M | Recombinant Mouse RPL10 Protein | +Inquiry |
| RPL10-3786R | Recombinant Rhesus Macaque RPL10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RPL10-10385Z | Recombinant Zebrafish RPL10 | +Inquiry |
| RPL10-867C | Recombinant Cynomolgus RPL10 Protein, His-tagged | +Inquiry |
| RPL10-2590F | Recombinant Fruit Fly RPL10 Protein (1-218 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RPL10-2230HCL | Recombinant Human RPL10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPL10 Products
Required fields are marked with *
My Review for All RPL10 Products
Required fields are marked with *



