Recombinant Fruit Fly RPL10 Protein (1-218 aa), His-tagged

• Cat.No.: RPL10-2590F
• Product Overview: Recombinant Fruit Fly (Drosophila melanogaster) RPL10 Protein (1-218 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.

Specification

• Species: Fruit Fly
• Source: E.coli
• Tag: His
• Protein Length: 1-218 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 29.5 kDa
• AA Sequence: MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGCNVKYRPEHGPIAAWEKAQRDVYA
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: RpL10 Ribosomal protein L10 [ Drosophila melanogaster (fruit fly) ]
• Official Symbol: RPL10
• Synonyms: RpL10; anon-EST:Posey179; BcDNA:LD24589; CG17521; Dmel\CG17521; DQM; L10; qm; Qm; Rp L10
• Gene ID: 43864
• mRNA Refseq: NM_001275304
• Protein Refseq: NP_001262233
• UniProt ID: O61231