Recombinant Full Length Arabidopsis Thaliana Casparian Strip Membrane Protein 2(Casp2) Protein, His-Tagged
Cat.No. : | RFL9758AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Casparian strip membrane protein 2(CASP2) Protein (Q9CAX3) (1-204aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-204) |
Form : | Lyophilized powder |
AA Sequence : | MKNESTFIDVPAESSSAMKGKAPLIGVARDHTTSGSGGYNRGLAIFDFLLRLAAIVAALA AAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTILRPL ATAPRLLLLVLDTGVLALNTAAASSAAAISYLAHSGNQNTNWLPICQQFGDFCQKSSGAV VSAFVSVVFFTILVVISGVALKRH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CASP2 |
Synonyms | CASP2; At3g11550; F24K9.22; Casparian strip membrane protein 2; AtCASP2 |
UniProt ID | Q9CAX3 |
◆ Recombinant Proteins | ||
CASP2-4013C | Recombinant Chicken CASP2 | +Inquiry |
CASP2-484H | Recombinant Human CASP2 | +Inquiry |
CASP2-195H | Recombinant Human CASP2, His-tagged | +Inquiry |
CASP2-296H | Recombinant Human CASP2 Protein, His/GST-tagged | +Inquiry |
CASP2-747H | Recombinant Human Caspase 2, Apoptosis-related Cysteine Peptidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP2-285HCL | Recombinant Human CASP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP2 Products
Required fields are marked with *
My Review for All CASP2 Products
Required fields are marked with *