Recombinant Human CASP2 protein, His-tagged
Cat.No. : | CASP2-2715H |
Product Overview : | Recombinant Human CASP2 protein(18-217 aa), fused to His tag, was expressed in E. coli. |
Availability | October 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 18-217 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CASP2 caspase 2, apoptosis-related cysteine peptidase [ Homo sapiens ] |
Official Symbol | CASP2 |
Synonyms | CASP2; caspase 2, apoptosis-related cysteine peptidase; NEDD2, neural precursor cell expressed, developmentally down regulated 2; caspase-2; ICH1; PPP1R57; protein phosphatase 1; regulatory subunit 57; protease ICH-1; protein phosphatase 1, regulatory subunit 57; neural precursor cell expressed developmentally down-regulated protein 2; NEDD2; CASP-2; NEDD-2; |
Gene ID | 835 |
mRNA Refseq | NM_001224 |
Protein Refseq | NP_001215 |
MIM | 600639 |
UniProt ID | P42575 |
◆ Recombinant Proteins | ||
CASP2-2926HF | Recombinant Full Length Human CASP2 Protein, GST-tagged | +Inquiry |
Casp2-297M | Recombinant Mouse Casp2 Protein, His-tagged | +Inquiry |
RFL9758AF | Recombinant Full Length Arabidopsis Thaliana Casparian Strip Membrane Protein 2(Casp2) Protein, His-Tagged | +Inquiry |
CASP2-747H | Recombinant Human Caspase 2, Apoptosis-related Cysteine Peptidase | +Inquiry |
CASP2-195H | Recombinant Human CASP2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP2-285HCL | Recombinant Human CASP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP2 Products
Required fields are marked with *
My Review for All CASP2 Products
Required fields are marked with *