Recombinant Human CASP2 protein, His-tagged

Cat.No. : CASP2-2715H
Product Overview : Recombinant Human CASP2 protein(18-217 aa), fused to His tag, was expressed in E. coli.
Availability November 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 18-217 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELE
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CASP2 caspase 2, apoptosis-related cysteine peptidase [ Homo sapiens ]
Official Symbol CASP2
Synonyms CASP2; caspase 2, apoptosis-related cysteine peptidase; NEDD2, neural precursor cell expressed, developmentally down regulated 2; caspase-2; ICH1; PPP1R57; protein phosphatase 1; regulatory subunit 57; protease ICH-1; protein phosphatase 1, regulatory subunit 57; neural precursor cell expressed developmentally down-regulated protein 2; NEDD2; CASP-2; NEDD-2;
Gene ID 835
mRNA Refseq NM_001224
Protein Refseq NP_001215
MIM 600639
UniProt ID P42575

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CASP2 Products

Required fields are marked with *

My Review for All CASP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon