Recombinant Full Length Arabidopsis Thaliana Casparian Strip Membrane Protein 5(Casp5) Protein, His-Tagged
Cat.No. : | RFL14077AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Casparian strip membrane protein 5(CASP5) Protein (Q9LXF3) (1-187aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-187) |
Form : | Lyophilized powder |
AA Sequence : | MKSGQAEIMETSKGIQKSGLMSRRIAILEFILRIVAFFNTIGSAILMGTTHETLPFFTQF IRFQAEYNDLPALTFFVVANAVVSGYLILSLTLAFVHIVKRKTQNTRILLIILDVAMLGL LTSGASSAAAIVYLAHNGNNKTNWFAICQQFNSFCERISGSLIGSFIAIVLLILLILLSA IALSRRH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CASP5 |
Synonyms | CASP5; At5g15290; F8M21_180; Casparian strip membrane protein 5; AtCASP5 |
UniProt ID | Q9LXF3 |
◆ Recombinant Proteins | ||
CASP5-821H | Recombinant Human CASP5 Protein, His-tagged | +Inquiry |
CASP5-2637H | Recombinant Human CASP5 protein, His-SUMO-tagged | +Inquiry |
CASP5-0859H | Recombinant Human CASP5 Protein (Pro145-Asp327), His tagged | +Inquiry |
CASP5-0860H | Recombinant Human CASP5 Protein (Ile182-Asp327), N-His tagged | +Inquiry |
CASP5-01H | Active Recombinant Human CASP5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP5-7835HCL | Recombinant Human CASP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP5 Products
Required fields are marked with *
My Review for All CASP5 Products
Required fields are marked with *