Recombinant Full Length Arabidopsis Thaliana Nudix Hydrolase 11(Nudt11) Protein, His-Tagged
Cat.No. : | RFL31148AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Nudix hydrolase 11(NUDT11) Protein (Q8LET2) (1-222aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-222) |
Form : | Lyophilized powder |
AA Sequence : | MSSTTTDSTELQNLIKLFQNCQTHPRQHFPAKSSAVLVCLYQEQREDKNELRVILTKRST TLSSHPGEVALPGGKRDQEDKDDIATALREAREEIGLDPSLVTIISVLEPFVNKKGMSVA PVIGFLHDKKAFKQLPNPAEVEEIFDVPLEMFLKDRNRRAEEREHEGERYLLQYFDYYSE DKERSFIIWALTAGILIRVASIVYQRLPEFQERKPSFWNQPN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NUDT11 |
Synonyms | NUDT11; NUDX11; At5g45940; K15I22.14; Nudix hydrolase 11; AtNUDT11; Coenzyme A diphosphatase NUDT11 |
UniProt ID | Q8LET2 |
◆ Recombinant Proteins | ||
NUDT11-1400H | Recombinant Human NUDT11, GST-tagged | +Inquiry |
Nudt11-4533M | Recombinant Mouse Nudt11 Protein, Myc/DDK-tagged | +Inquiry |
NUDT11-2097HFL | Recombinant Full Length Human NUDT11 Protein, C-Flag-tagged | +Inquiry |
RFL31148AF | Recombinant Full Length Arabidopsis Thaliana Nudix Hydrolase 11(Nudt11) Protein, His-Tagged | +Inquiry |
NUDT11-1559H | Recombinant Human NUDT11 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT11-3653HCL | Recombinant Human NUDT11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUDT11 Products
Required fields are marked with *
My Review for All NUDT11 Products
Required fields are marked with *
0
Inquiry Basket