Recombinant Human NUDT11 protein, His-tagged
Cat.No. : | NUDT11-3095H |
Product Overview : | Recombinant Human NUDT11 protein(1-164 aa), fused to His tag, was expressed in E. coli. |
Availability | May 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-164 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NUDT11 nudix (nucleoside diphosphate linked moiety X)-type motif 11 [ Homo sapiens (human) ] |
Official Symbol | NUDT11 |
Synonyms | NUDT11; APS1; ASP1; DIPP3b; DIPP3beta; hDIPP3beta; nudix (nucleoside diphosphate linked moiety X)-type motif 11; diphosphoinositol polyphosphate phosphohydrolase 3-beta; hAps1; DIPP3-beta; DIPP-3-beta; nudix motif 11; nucleoside diphosphate-linked moiety X motif 11; diadenosine hexaphosphate hydrolase (AMP-forming); diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 3-beta; diphosphoinositol polyphosphate phosphohydrolase 3, beta; EC 3.6.1.52; EC 3.6.1.60 |
Gene ID | 55190 |
mRNA Refseq | NM_018159 |
Protein Refseq | NP_060629 |
MIM | 300528 |
UniProt ID | Q96G61 |
◆ Recombinant Proteins | ||
NUDT11-2097HFL | Recombinant Full Length Human NUDT11 Protein, C-Flag-tagged | +Inquiry |
NUDT11-418H | Recombinant Human NUDT11 | +Inquiry |
RFL31148AF | Recombinant Full Length Arabidopsis Thaliana Nudix Hydrolase 11(Nudt11) Protein, His-Tagged | +Inquiry |
NUDT11-1559H | Recombinant Human NUDT11 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUDT11-1400H | Recombinant Human NUDT11, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT11-3653HCL | Recombinant Human NUDT11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUDT11 Products
Required fields are marked with *
My Review for All NUDT11 Products
Required fields are marked with *
0
Inquiry Basket