Recombinant Human NUDT11 protein, His-tagged

Cat.No. : NUDT11-3095H
Product Overview : Recombinant Human NUDT11 protein(1-164 aa), fused to His tag, was expressed in E. coli.
Availability July 16, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-164 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name NUDT11 nudix (nucleoside diphosphate linked moiety X)-type motif 11 [ Homo sapiens (human) ]
Official Symbol NUDT11
Synonyms NUDT11; APS1; ASP1; DIPP3b; DIPP3beta; hDIPP3beta; nudix (nucleoside diphosphate linked moiety X)-type motif 11; diphosphoinositol polyphosphate phosphohydrolase 3-beta; hAps1; DIPP3-beta; DIPP-3-beta; nudix motif 11; nucleoside diphosphate-linked moiety X motif 11; diadenosine hexaphosphate hydrolase (AMP-forming); diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 3-beta; diphosphoinositol polyphosphate phosphohydrolase 3, beta; EC 3.6.1.52; EC 3.6.1.60
Gene ID 55190
mRNA Refseq NM_018159
Protein Refseq NP_060629
MIM 300528
UniProt ID Q96G61

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUDT11 Products

Required fields are marked with *

My Review for All NUDT11 Products

Required fields are marked with *

0
cart-icon
0
compare icon