Recombinant Full Length Arabidopsis Thaliana Translocator Protein Homolog(Tspo) Protein, His-Tagged
| Cat.No. : | RFL20879AF |
| Product Overview : | Recombinant Full Length Arabidopsis thaliana Translocator protein homolog(TSPO) Protein (O82245) (1-196aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Arabidopsis thaliana |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-196) |
| Form : | Lyophilized powder |
| AA Sequence : | MDSQDIRYRGGDDRDAATTAMAETERKSADDNKGKRDQKRAMAKRGLKSLTVAVAAPVLV TLFATYFLGTSDGYGNRAKSSSWIPPLWLLHTTCLASSGLMGLAAWLVWVDGGFHKKPNA LYLYLAQFLLCLVWDPVTFRVGSGVAGLAVWLGQSAALFGCYKAFNEISPVAGNLVKPCL AWAAFVAAVNVKLAVA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | TSPO |
| Synonyms | TSPO; At2g47770; F17A22.16; Translocator protein homolog; AtTSPO |
| UniProt ID | O82245 |
| ◆ Recombinant Proteins | ||
| TSPO-2722P | Recombinant Pig TSPO Full Length Transmembrane protein (1-169 aa), His-SUMO-Myc-tagged | +Inquiry |
| TSPO-142HFL | Active Recombinant Full Length Human TSPO Protein, C-Flag-tagged | +Inquiry |
| TSPO-9691M | Recombinant Mouse TSPO Protein, His (Fc)-Avi-tagged | +Inquiry |
| TSPO-51H | Recombinant Human TSPO, MYC/DDK-tagged | +Inquiry |
| TSPO-17519M | Recombinant Mouse TSPO Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TSPO-703HCL | Recombinant Human TSPO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSPO Products
Required fields are marked with *
My Review for All TSPO Products
Required fields are marked with *
