Recombinant Full Length Ashbya Gossypii Phosphatidylinositol N-Acetylglucosaminyltransferase Eri1 Subunit(Eri1) Protein, His-Tagged
Cat.No. : | RFL12624AF |
Product Overview : | Recombinant Full Length Ashbya gossypii Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit(ERI1) Protein (Q75D30) (1-71aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-71) |
Form : | Lyophilized powder |
AA Sequence : | MNDKVAATLVLVVTYSIVGASLWCLTYAWHDETKLYYWCIVQLLPVMLWVWCVISWCGAQ LFGYAKRGKAD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERI1 |
Synonyms | ERI1; ABR192C-A; Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit; Endoplasmic reticulum-associated Ras inhibitor protein 1 |
UniProt ID | Q75D30 |
◆ Recombinant Proteins | ||
ERI1-2849M | Recombinant Mouse ERI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ERI1-5300M | Recombinant Mouse ERI1 Protein | +Inquiry |
ERI1-1590C | Recombinant Chicken ERI1 | +Inquiry |
ERI1-2138R | Recombinant Rat ERI1 Protein | +Inquiry |
RFL12624AF | Recombinant Full Length Ashbya Gossypii Phosphatidylinositol N-Acetylglucosaminyltransferase Eri1 Subunit(Eri1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERI1-6554HCL | Recombinant Human ERI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERI1 Products
Required fields are marked with *
My Review for All ERI1 Products
Required fields are marked with *