Recombinant Full Length Bacillus Subtilis Putative Abc Transporter Permease Protein Amyc(Amyc) Protein, His-Tagged
Cat.No. : | RFL18257BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Putative ABC transporter permease protein AmyC(amyC) Protein (O34518) (1-276aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-276) |
Form : | Lyophilized powder |
AA Sequence : | MRAARTKSMRIITLLAAIVACAHFIPFYILLTTSLKAKGDYSSKWIFPADISFHNFSEAW ERASLGNSFINTMIITGFSALLLIIFGSLAAYPLARRETKLNKAVFALLISIMIIPPLTS MVPLYRMVVDAGMVNTHAIAIFINTAAYMPLTVFLYSGFIRSTIPKELVEAARIDGAGML KIFFTIVFPLLKPITATICIISCVFIWNDYQFAIFFLQDQKVQTLTVAMAGFFGENANNL HLVAAAALMAMLPMVVLFLALQKYFIAGLSSGAVKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | amyC |
Synonyms | melC; amyC; BSU30290; Melibiose/raffinose/stachyose import permease protein MelC |
UniProt ID | O34518 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All amyC Products
Required fields are marked with *
My Review for All amyC Products
Required fields are marked with *
0
Inquiry Basket