Recombinant Full Length Bovine 2-Acylglycerol O-Acyltransferase 1(Mogat1) Protein, His-Tagged
Cat.No. : | RFL5476BF |
Product Overview : | Recombinant Full Length Bovine 2-acylglycerol O-acyltransferase 1(MOGAT1) Protein (Q70VZ7) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-335) |
Form : | Lyophilized powder |
AA Sequence : | MKVEFAPLNIPLARRLQTAAVLHWLLSFLLFAQVCLGIIVFLIIYNYWFLYLPYLTWLYF DWQTPEQGGRRSEWVRNWAIWRYFKDYFPIHLIKTWDLDPSHNYIFGFHPHGVLVVGAFG NFCTNYSAFKELFPGFTSYLHVLPYWFRCPLFREYLMSSGPVSVSKKSVCHVLSKEGGGN ISVIVLGGAEESLDAHPGKFTLFIRQRKGFVKIALTHGAYLVPVFSFGENELFKQVSNPE GSWLRNVQEKLQKIMGFALPLFHARGIFQYNFGLIPYRKPIHTVVGRPIPVRQTLNPTSE QIEELHQTYMEELRKLFEEHKGKYGIPENETLIFR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MOGAT1 |
Synonyms | MOGAT1; 2-acylglycerol O-acyltransferase 1; Acyl CoA:monoacylglycerol acyltransferase 1; MGAT1; Monoacylglycerol O-acyltransferase 1 |
UniProt ID | Q70VZ7 |
◆ Recombinant Proteins | ||
MOGAT1-6303HF | Recombinant Full Length Human MOGAT1 Protein, GST-tagged | +Inquiry |
MOGAT1-5467H | Recombinant Human MOGAT1 Protein, GST-tagged | +Inquiry |
RFL5476BF | Recombinant Full Length Bovine 2-Acylglycerol O-Acyltransferase 1(Mogat1) Protein, His-Tagged | +Inquiry |
MOGAT1-9952M | Recombinant Mouse MOGAT1 Protein | +Inquiry |
RFL27067MF | Recombinant Full Length Mouse 2-Acylglycerol O-Acyltransferase 1(Mogat1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOGAT1-1127HCL | Recombinant Human MOGAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOGAT1 Products
Required fields are marked with *
My Review for All MOGAT1 Products
Required fields are marked with *