Recombinant Full Length Bovine Acyl-Coa-Binding Domain-Containing Protein 5(Acbd5) Protein, His-Tagged
Cat.No. : | RFL-25121BF |
Product Overview : | Recombinant Full Length Bovine Acyl-CoA-binding domain-containing protein 5(ACBD5) Protein (P07106) (1-533aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-533) |
Form : | Lyophilized powder |
AA Sequence : | MFQFHAGSWESWCCCCCLIPGDRPWDRGRRWRLEMADTRSVHETRFEAAVKVIQSLPKNG SFQPTNEMMLKFYSFYKQATEGPCKLSKPGFWDPVGRYKWDAWSSLGDMTKEEAMIAYVE EMKKILETMPMTEKVEELLHVIGPFYEIVEDKKSGRSSDLTSVRLEKISKCLEDLGNVLA STPNAKTVNGKAESSDSGAESEEEAAQEDPKRPEPRDSDKKMMKKSADHKNLEIIVTNGY DKDSFVQGVQNSIHTSPSLNGRCTEEVKSVDENLEQTGKTVVFVHQDVNSDHVEDISGIQ HLTSDSDSEVYCDSMEQFGQEESLDGFISNNGPFSYYLGGNPSQPLESSGFPEAVQGLPG NGSPEDMQGAVVEGKGEVKRGGEDGGSNSGAPHREKRAGESEEFSNIRRGRGHRMQHLSE GSKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMRLQEDMQNVLQRLHKLEMLAASQAK SSALQTSNQPTSPRPSWWPFEMSPGALTFAIIWPFIAQWLVHLYYQRRRRKLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ACBD5 |
Synonyms | ACBD5; DBI; Acyl-CoA-binding domain-containing protein 5; Endozepine-related protein; Membrane-associated diazepam-binding inhibitor; MA-DBI |
UniProt ID | P07106 |
◆ Recombinant Proteins | ||
ACBD5-764HF | Recombinant Full Length Human ACBD5 Protein, GST-tagged | +Inquiry |
Acbd5-1491M | Recombinant Mouse Acbd5 Protein, Myc/DDK-tagged | +Inquiry |
ACBD5-9280H | Recombinant Human ACBD5, GST-tagged | +Inquiry |
RFL23176XF | Recombinant Full Length Xenopus Laevis Acyl-Coa-Binding Domain-Containing Protein 5(Acbd5) Protein, His-Tagged | +Inquiry |
ACBD5-1033H | Recombinant Human ACBD5 Protein (1-461 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACBD5-9105HCL | Recombinant Human ACBD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACBD5 Products
Required fields are marked with *
My Review for All ACBD5 Products
Required fields are marked with *
0
Inquiry Basket