Recombinant Full Length Bovine Adenosine Receptor A2B(Adora2B) Protein, His-Tagged
Cat.No. : | RFL22198BF |
Product Overview : | Recombinant Full Length Bovine Adenosine receptor A2b(ADORA2B) Protein (Q1LZD0) (1-332aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-332) |
Form : | Lyophilized powder |
AA Sequence : | MPLEAQDAVYVALELALAALSVTGNVLVCAAVGTSSALQTPTNYFLVSLAAADVAVGLFA IPFAVTISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAVRVPLRYKSLVTGA RARGVIAALWVLAFGIGLTPFLGWNDRKIATNCTEPGDAATNVSCCLIRCLFENVVPMSY MVYFNFFGCVLPPLLIMLVIYVKIFLVACRQLQRTELMDHSRTVLQREIHAAKSLALIVG IFALCWLPVHTINCASLFQPTWAKVKPKWAINTAILLSHANSAVNPIVYAYRNRDFRYTF HKIISRYILCRTHILKSGEGQVGSQPTLQLGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ADORA2B |
Synonyms | ADORA2B; Adenosine receptor A2b |
UniProt ID | Q1LZD0 |
◆ Recombinant Proteins | ||
RFL-8285GF | Recombinant Full Length Chicken Adenosine Receptor A2B(Adora2B) Protein, His-Tagged | +Inquiry |
RFL22198BF | Recombinant Full Length Bovine Adenosine Receptor A2B(Adora2B) Protein, His-Tagged | +Inquiry |
ADORA2B-370H | Recombinant Human ADORA2B Protein | +Inquiry |
ADORA2B-6744H | Recombinant Human ADORA2B protein, His-tagged | +Inquiry |
ADORA2B-972HF | Recombinant Full Length Human ADORA2B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADORA2B-9005HCL | Recombinant Human ADORA2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADORA2B Products
Required fields are marked with *
My Review for All ADORA2B Products
Required fields are marked with *
0
Inquiry Basket