Recombinant Full Length Bovine Cd9 Antigen(Cd9) Protein, His-Tagged
Cat.No. : | RFL10446BF |
Product Overview : | Recombinant Full Length Bovine CD9 antigen(CD9) Protein (P30932) (2-226aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-226) |
Form : | Lyophilized powder |
AA Sequence : | PVKGGTKCIKYLLFGFNFIFWLAGIAVLSVGLWLRFDSQTKSIFEQENNDSSFYTGVYIL IGAGALMMLVGFLGCCGAVQESQCMLGLFFSFLLVIFAIEVAAAIWGYSHKEEVIKEVQK FYEDTYNKLKNKDEPQRETLKAIHIALDCCGLTGVPEQFLTDTCPPKNLIDSLKTRPCPE AIDEIFRSKFHIIGAVGIGIAVVMIFGMVFSMILCCAIRRNRDMV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD9 |
Synonyms | CD9; CD9 antigen; CD antigen CD9 |
UniProt ID | P30932 |
◆ Recombinant Proteins | ||
CD9-151H | Recombinant Human CD9 Protein, DYKDDDDK-tagged | +Inquiry |
Cd9-852M | Recombinant Mouse Cd9 Protein, MYC/DDK-tagged | +Inquiry |
CD9-79HFL | Active Recombinant Full Length Human CD9 Protein, C-Flag-tagged | +Inquiry |
CD9-6464H | Recombinant Human CD9 protein, His&Myc-tagged | +Inquiry |
CD9-2958H | Recombinant Human CD9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD9-2110HCL | Recombinant Human CD9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD9 Products
Required fields are marked with *
My Review for All CD9 Products
Required fields are marked with *
0
Inquiry Basket