Recombinant Full Length Bovine E3 Ubiquitin-Protein Ligase Trim13(Trim13) Protein, His-Tagged
Cat.No. : | RFL20453BF |
Product Overview : | Recombinant Full Length Bovine E3 ubiquitin-protein ligase TRIM13(TRIM13) Protein (Q32L60) (1-407aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-407) |
Form : | Lyophilized powder |
AA Sequence : | MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGNVRNSLWRSSPFKCPTCRKE TSATGVNSLQVNYSLKGIVEKYNKIKVSPKMPVCKGHLGQPLNIFCLTDMQLICGICATR GEHTKHVFCSIEDAYAQERDAFESLFQSFETWRRGDALSRLDTLETSKRKSLQLLTKDSD KVKEFFEKLQYTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQRMAFNIAEAFK DVSEPIIFLQQMQEFREKIKVIKETPLPPSNLPSSPLMKNFDTSQWEDIKLVDVDKLSLP QDTGTFISKIPWRLYPLFVVVILLGLLIFFSPTMFLEWSLFDEIATWKDNLSNFSSYLTR SADFVEQSVFYWEQLTDGLFIFSERLKSFTLVVLNNVAEFVCKYKLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TRIM13 |
Synonyms | TRIM13; RFP2; E3 ubiquitin-protein ligase TRIM13; Putative tumor suppressor RFP2; RING-type E3 ubiquitin transferase TRIM13; Ret finger protein 2; Tripartite motif-containing protein 13 |
UniProt ID | Q32L60 |
◆ Recombinant Proteins | ||
RFL20453BF | Recombinant Full Length Bovine E3 Ubiquitin-Protein Ligase Trim13(Trim13) Protein, His-Tagged | +Inquiry |
TRIM13-2783Z | Recombinant Zebrafish TRIM13 | +Inquiry |
RFL10594MF | Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase Trim13(Trim13) Protein, His-Tagged | +Inquiry |
Trim13-6644M | Recombinant Mouse Trim13 Protein, Myc/DDK-tagged | +Inquiry |
TRIM13-2018H | Recombinant Human TRIM13 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM13-795HCL | Recombinant Human TRIM13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM13 Products
Required fields are marked with *
My Review for All TRIM13 Products
Required fields are marked with *