Recombinant Full Length Bovine Fibronectin Type Iii Domain-Containing Protein 4(Fndc4) Protein, His-Tagged
Cat.No. : | RFL25848BF |
Product Overview : | Recombinant Full Length Bovine Fibronectin type III domain-containing protein 4(FNDC4) Protein (A6QPL2) (41-230aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (41-230) |
Form : | Lyophilized powder |
AA Sequence : | DRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FNDC4 |
Synonyms | FNDC4; FRCP1; Fibronectin type III domain-containing protein 4; Fibronectin type III repeat-containing protein 1 |
UniProt ID | A6QPL2 |
◆ Recombinant Proteins | ||
FNDC4-4330H | Recombinant Human FNDC4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FNDC4-5007HF | Recombinant Full Length Human FNDC4 Protein, GST-tagged | +Inquiry |
Fndc4-3064M | Recombinant Mouse Fndc4 Protein, Myc/DDK-tagged | +Inquiry |
FNDC4-1094HFL | Recombinant Full Length Human FNDC4 Protein, C-Flag-tagged | +Inquiry |
FNDC4-929H | Recombinant Human FNDC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FNDC4-6173HCL | Recombinant Human FNDC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FNDC4 Products
Required fields are marked with *
My Review for All FNDC4 Products
Required fields are marked with *