Recombinant Full Length Bovine Fibronectin Type Iii Domain-Containing Protein 4(Fndc4) Protein, His-Tagged
| Cat.No. : | RFL25848BF |
| Product Overview : | Recombinant Full Length Bovine Fibronectin type III domain-containing protein 4(FNDC4) Protein (A6QPL2) (41-230aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (41-230) |
| Form : | Lyophilized powder |
| AA Sequence : | DRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | FNDC4 |
| Synonyms | FNDC4; FRCP1; Fibronectin type III domain-containing protein 4; Fibronectin type III repeat-containing protein 1 |
| UniProt ID | A6QPL2 |
| ◆ Recombinant Proteins | ||
| FNDC4-4408H | Recombinant Human FNDC4 Protein, GST-tagged | +Inquiry |
| FNDC4-1094HFL | Recombinant Full Length Human FNDC4 Protein, C-Flag-tagged | +Inquiry |
| FNDC4-4330H | Recombinant Human FNDC4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FNDC4-121H | Recombinant Human FNDC4 protein, T7/His-tagged | +Inquiry |
| RFL25848BF | Recombinant Full Length Bovine Fibronectin Type Iii Domain-Containing Protein 4(Fndc4) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FNDC4-6173HCL | Recombinant Human FNDC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FNDC4 Products
Required fields are marked with *
My Review for All FNDC4 Products
Required fields are marked with *
