Recombinant Human FNDC4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FNDC4-4330H |
Product Overview : | FNDC4 MS Standard C13 and N15-labeled recombinant protein (NP_073734) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Acts as an anti-inflammatory factor in the intestine and colon. Binds to and acts on macrophages to downregulate pro-inflammatory gene expression. Affects key macrophage functions, including phagocytosis, by downregulating many key pathways for macrophage activation, partly via by STAT3 activation and signaling. May be required to dampen the immunological response in colitis. |
Molecular Mass : | 25.2 kDa |
AA Sequence : | MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FNDC4 fibronectin type III domain containing 4 [ Homo sapiens (human) ] |
Official Symbol | FNDC4 |
Synonyms | FNDC4; fibronectin type III domain containing 4; fibronectin type III domain-containing protein 4; FLJ22362; FRCP1; fibronectin type III repeat-containing protein 1; |
Gene ID | 64838 |
mRNA Refseq | NM_022823 |
Protein Refseq | NP_073734 |
MIM | 611905 |
UniProt ID | Q9H6D8 |
◆ Recombinant Proteins | ||
FNDC4-121H | Recombinant Human FNDC4 protein, T7/His-tagged | +Inquiry |
RFL25848BF | Recombinant Full Length Bovine Fibronectin Type Iii Domain-Containing Protein 4(Fndc4) Protein, His-Tagged | +Inquiry |
FNDC4-1094HFL | Recombinant Full Length Human FNDC4 Protein, C-Flag-tagged | +Inquiry |
Fndc4-3064M | Recombinant Mouse Fndc4 Protein, Myc/DDK-tagged | +Inquiry |
FNDC4-929H | Recombinant Human FNDC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FNDC4-6173HCL | Recombinant Human FNDC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FNDC4 Products
Required fields are marked with *
My Review for All FNDC4 Products
Required fields are marked with *
0
Inquiry Basket