Recombinant Full Length Bovine Leptin Receptor Overlapping Transcript-Like 1(Leprotl1) Protein, His-Tagged
| Cat.No. : | RFL16520BF |
| Product Overview : | Recombinant Full Length Bovine Leptin receptor overlapping transcript-like 1(LEPROTL1) Protein (Q32PD8) (1-131aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-131) |
| Form : | Lyophilized powder |
| AA Sequence : | MAGIKALISLSFGGAIGLMFLMLGCALPIYNQYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPIVFARANLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | LEPROTL1 |
| Synonyms | LEPROTL1; Leptin receptor overlapping transcript-like 1 |
| UniProt ID | Q32PD8 |
| ◆ Recombinant Proteins | ||
| LEPROTL1-9055M | Recombinant Mouse LEPROTL1 Protein | +Inquiry |
| LEPROTL1-5048M | Recombinant Mouse LEPROTL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Leprotl1-3775M | Recombinant Mouse Leprotl1 Protein, Myc/DDK-tagged | +Inquiry |
| RFL1357PF | Recombinant Full Length Pongo Abelii Leptin Receptor Overlapping Transcript-Like 1(Leprotl1) Protein, His-Tagged | +Inquiry |
| LEPROTL1-1599H | Recombinant Human LEPROTL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEPROTL1 Products
Required fields are marked with *
My Review for All LEPROTL1 Products
Required fields are marked with *
