Recombinant Full Length Bovine Microsomal Glutathione S-Transferase 2(Mgst2) Protein, His-Tagged
Cat.No. : | RFL16467BF |
Product Overview : | Recombinant Full Length Bovine Microsomal glutathione S-transferase 2(MGST2) Protein (Q2KJG4) (1-146aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-146) |
Form : | Lyophilized powder |
AA Sequence : | MAGNSILLAALSVLSACQQSYFAMQVGKARSKYKVTPPSVSGSPDFERIFRAQQNCVEFY PIFIITLWMAGWYFNQVFATCLGLVYIYSRHQYFWGYAEAAKKRVTGFRLSLGVLALLTV LGAVGILNSFLDEYLDIDIAKKLRHF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MGST2 |
Synonyms | MGST2; Microsomal glutathione S-transferase 2; Microsomal GST-2; Glutathione peroxidase MGST2; Leukotriene C4 synthase MGST2; Microsomal glutathione S-transferase II; Microsomal GST-II |
UniProt ID | Q2KJG4 |
◆ Recombinant Proteins | ||
MGST2-439C | Recombinant Cynomolgus Monkey MGST2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MGST2-5310H | Recombinant Human MGST2 Protein, GST-tagged | +Inquiry |
MGST2-693C | Recombinant Cynomolgus MGST2 Protein, His-tagged | +Inquiry |
MGST2-2766R | Recombinant Rhesus monkey MGST2 Protein, His-tagged | +Inquiry |
MGST2-2383H | Recombinant Human MGST2 Full Length Transmembrane protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGST2-4327HCL | Recombinant Human MGST2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGST2 Products
Required fields are marked with *
My Review for All MGST2 Products
Required fields are marked with *