Recombinant Full Length Bovine Mitochondrial Import Receptor Subunit Tom20 Homolog(Tomm20) Protein, His-Tagged
Cat.No. : | RFL2041BF |
Product Overview : | Recombinant Full Length Bovine Mitochondrial import receptor subunit TOM20 homolog(TOMM20) Protein (A6H7B1) (1-145aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-145) |
Form : | Lyophilized powder |
AA Sequence : | MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TOMM20 |
Synonyms | TOMM20; Mitochondrial import receptor subunit TOM20 homolog; Mitochondrial 20 kDa outer membrane protein; Outer mitochondrial membrane receptor Tom20 |
UniProt ID | A6H7B1 |
◆ Recombinant Proteins | ||
TOMM20-5873R | Recombinant Rat TOMM20 Protein, His (Fc)-Avi-tagged | +Inquiry |
TOMM20-4706R | Recombinant Rhesus Macaque TOMM20 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL2041BF | Recombinant Full Length Bovine Mitochondrial Import Receptor Subunit Tom20 Homolog(Tomm20) Protein, His-Tagged | +Inquiry |
TOMM20-800HFL | Recombinant Full Length Human TOMM20 Protein, C-Flag-tagged | +Inquiry |
TOMM20-6216R | Recombinant Rat TOMM20 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TOMM20-872HCL | Recombinant Human TOMM20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOMM20 Products
Required fields are marked with *
My Review for All TOMM20 Products
Required fields are marked with *