Recombinant Full Length Human TOMM20 Protein, C-Flag-tagged
| Cat.No. : | TOMM20-800HFL |
| Product Overview : | Recombinant Full Length Human TOMM20 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables protein-transporting ATPase activity and unfolded protein binding activity. Involved in protein targeting to mitochondrion. Located in mitochondria-associated endoplasmic reticulum membrane and mitochondrial outer membrane. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 16.1 kDa |
| AA Sequence : | MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFF LEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLA EDDVETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Transmembrane |
| Full Length : | Full L. |
| Gene Name | TOMM20 translocase of outer mitochondrial membrane 20 [ Homo sapiens (human) ] |
| Official Symbol | TOMM20 |
| Synonyms | MAS20; MOM19; TOM20 |
| Gene ID | 9804 |
| mRNA Refseq | NM_014765.3 |
| Protein Refseq | NP_055580.1 |
| MIM | 601848 |
| UniProt ID | Q15388 |
| ◆ Cell & Tissue Lysates | ||
| TOMM20-872HCL | Recombinant Human TOMM20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOMM20 Products
Required fields are marked with *
My Review for All TOMM20 Products
Required fields are marked with *
