Recombinant Full Length Bovine Transmembrane Protein 173(Tmem173) Protein, His-Tagged
Cat.No. : | RFL28001BF |
Product Overview : | Recombinant Full Length Bovine Transmembrane protein 173(TMEM173) Protein (Q2KI99) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MPHSSLHPSIPQPRGLRAQKAALVLLSACLVALWGLGEPPDYTLKWLVLHLASQQMGLLI KGICSLAEELCHVHSRYHGSYWRAVRACLCSSMRCGALLLLSCYFYCSLPNMADLPFTWM LALLGLSQALNILLGLQGLAPAEVSAICEKRNFNVAHGLAWSYYIGYLRLILPGLPARIQ IYNQFHNNTLQGAGSHRLHILFPLDCGVPDDLNVADPNIRFLHELPQQSADRAGIKGRVY TNSIYELLENGQRAGVCVLEYATPLQTLFAMSQDGRAGFSREDRLEQAKLFCRTLEDILA NAPESQNNCRLIVYQEPAEGSSFSLSQEILQHLRQEEREVTMGSTETSVMPGSSVLSQEP ELLISGLEKPLPLRSDVF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM173 |
Synonyms | STING1; TMEM173; Stimulator of interferon genes protein; STING; Transmembrane protein 173 |
UniProt ID | Q2KI99 |
◆ Recombinant Proteins | ||
TMEM173-3704H | Recombinant Human TMEM173 Protein (Leu139-Ser379), His tagged | +Inquiry |
TMEM173-1436H | Recombinant Human TMEM173 protein, His-tagged | +Inquiry |
Tmem173-1437M | Recombinant Mouse Tmem173 protein, His-tagged | +Inquiry |
RFL3874GF | Recombinant Full Length Chicken Transmembrane Protein 173(Tmem173) Protein, His-Tagged | +Inquiry |
TMEM173-5853H | Recombinant Human TMEM173 Protein (Gly138-Ser379), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM173-988HCL | Recombinant Human TMEM173 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM173 Products
Required fields are marked with *
My Review for All TMEM173 Products
Required fields are marked with *
0
Inquiry Basket