Recombinant Human TMEM173 protein, GST-tagged
| Cat.No. : | TMEM173-3281H |
| Product Overview : | Recombinant Human TMEM173 protein(174-379 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 30, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 174-379 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | ELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | TMEM173 transmembrane protein 173 [ Homo sapiens ] |
| Official Symbol | TMEM173 |
| Synonyms | TMEM173; transmembrane protein 173; FLJ38577; NET23; hMITA; hSTING; mediator of IRF3 activation; endoplasmic reticulum IFN stimulator; stimulator of interferon genes protein; mitochondrial mediator of IRF3 activation; endoplasmic reticulum interferon stimulator; N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner; ERIS; MITA; MPYS; STING; |
| Gene ID | 340061 |
| mRNA Refseq | NM_198282 |
| Protein Refseq | NP_938023 |
| MIM | 612374 |
| UniProt ID | Q86WV6 |
| ◆ Recombinant Proteins | ||
| TMEM173-3282H | Recombinant Human TMEM173 protein, His-tagged | +Inquiry |
| TMEM173-1436H | Recombinant Human TMEM173 protein, His-tagged | +Inquiry |
| TMEM173-284H | Recombinant Human TMEM173 Protein, MYC/DDK-tagged | +Inquiry |
| Tmem173-1437M | Recombinant Mouse Tmem173 protein, His-tagged | +Inquiry |
| RFL16898HF | Recombinant Full Length Human Stimulator Of Interferon Genes Protein(Tmem173) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMEM173-988HCL | Recombinant Human TMEM173 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM173 Products
Required fields are marked with *
My Review for All TMEM173 Products
Required fields are marked with *
