Recombinant Human TMEM173 protein, GST-tagged

• Cat.No.: TMEM173-3281H
• Product Overview: Recombinant Human TMEM173 protein(174-379 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 174-379 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: ELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: TMEM173 transmembrane protein 173 [ Homo sapiens ]
• Official Symbol: TMEM173
• Synonyms: TMEM173; transmembrane protein 173; FLJ38577; NET23; hMITA; hSTING; mediator of IRF3 activation; endoplasmic reticulum IFN stimulator; stimulator of interferon genes protein; mitochondrial mediator of IRF3 activation; endoplasmic reticulum interferon stimulator; N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner; ERIS; MITA; MPYS; STING
• Gene ID: 340061
• mRNA Refseq: NM_198282
• Protein Refseq: NP_938023
• MIM: 612374
• UniProt ID: Q86WV6