Recombinant Full Length Bovine Tricarboxylate Transport Protein, Mitochondrial(Slc25A1) Protein, His-Tagged
Cat.No. : | RFL22716BF |
Product Overview : | Recombinant Full Length Bovine Tricarboxylate transport protein, mitochondrial(SLC25A1) Protein (P79110) (14-311aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (14-311) |
Form : | Lyophilized powder |
AA Sequence : | SPGSGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQ TVRSHGLLGLYRGLSSLLYGSIPKAAVRFGTFEFLSNHMRDAQGRLDSTRGLLCGLGAGV PEAVVVVCPMETIKVKFIHDQTSASPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGS NQGIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEA HKYRNTLDCGLQILRNEGLKAFYKGTVPRLGRVCLDVAIVFIIYDEVVKLLNKVWKAD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC25A1 |
Synonyms | SLC25A1; SLC20A3; Tricarboxylate transport protein, mitochondrial; Citrate transport protein; CTP; Solute carrier family 25 member 1; Tricarboxylate carrier protein |
UniProt ID | P79110 |
◆ Recombinant Proteins | ||
SLC25A1-15294M | Recombinant Mouse SLC25A1 Protein | +Inquiry |
SLC25A1-4239R | Recombinant Rhesus monkey SLC25A1 Protein, His-tagged | +Inquiry |
SLC25A1-5127R | Recombinant Rat SLC25A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A1-2714H | Recombinant Human SLC25A1, His-tagged | +Inquiry |
RFL2624RF | Recombinant Full Length Rat Tricarboxylate Transport Protein, Mitochondrial(Slc25A1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A1-1786HCL | Recombinant Human SLC25A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A1 Products
Required fields are marked with *
My Review for All SLC25A1 Products
Required fields are marked with *