Recombinant Human SLC25A1 Protein (47-87 aa), GST-tagged
Cat.No. : | SLC25A1-1209H |
Product Overview : | Recombinant Human SLC25A1 Protein (47-87 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transport. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 47-87 aa |
Description : | Involved in citrate-H+/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD+ for the glycolytic pathway. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 31.8 kDa |
AA Sequence : | EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | SLC25A1 solute carrier family 25 member 1 [ Homo sapiens (human) ] |
Official Symbol | SLC25A1 |
Synonyms | CTP; SEA; CMS23; D2L2AD; SLC20A3; |
Gene ID | 6576 |
mRNA Refseq | NM_005984 |
Protein Refseq | NP_005975 |
UniProt ID | P53007 |
◆ Recombinant Proteins | ||
SLC25A1-5468R | Recombinant Rat SLC25A1 Protein | +Inquiry |
SLC25A1-5127R | Recombinant Rat SLC25A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL3270HF | Recombinant Full Length Human Tricarboxylate Transport Protein, Mitochondrial(Slc25A1) Protein, His-Tagged | +Inquiry |
SLC25A1-4055R | Recombinant Rhesus Macaque SLC25A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A1-15294M | Recombinant Mouse SLC25A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A1-1786HCL | Recombinant Human SLC25A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A1 Products
Required fields are marked with *
My Review for All SLC25A1 Products
Required fields are marked with *
0
Inquiry Basket