Recombinant Human SLC25A1 Protein (47-87 aa), GST-tagged

Cat.No. : SLC25A1-1209H
Product Overview : Recombinant Human SLC25A1 Protein (47-87 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transport. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 47-87 aa
Description : Involved in citrate-H+/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD+ for the glycolytic pathway.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 31.8 kDa
AA Sequence : EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name SLC25A1 solute carrier family 25 member 1 [ Homo sapiens (human) ]
Official Symbol SLC25A1
Synonyms CTP; SEA; CMS23; D2L2AD; SLC20A3;
Gene ID 6576
mRNA Refseq NM_005984
Protein Refseq NP_005975
UniProt ID P53007

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC25A1 Products

Required fields are marked with *

My Review for All SLC25A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon