Recombinant Full Length Bovine Tumor Necrosis Factor Receptor Superfamily Member 1A(Tnfrsf1A) Protein, His-Tagged
Cat.No. : | RFL16330BF |
Product Overview : | Recombinant Full Length Bovine Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A) Protein (O19131) (22-471aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-471) |
Form : | Lyophilized powder |
AA Sequence : | VYPAGVQGLVPHPGDLEKRESPCPQGKYNHPQNSTICCTKCHKGTYLYNDCPGPGRDTDCRVCAPGTYTALENHLRRCLSCSRCRDEMFQVEISPCVVDRDTVCGCRKNQYREYWGETGFRCLNCSLCPNGTVNIPCQERQDTICHCHMGFFLKGAKCISCHDCKNKECEKLCPTRPSTGKDSQDPGTTVLLPLVIVFGLCLASFASVVLACRYQRWKPKLYSIICGQSTLVKEGEPELLVPAPGFNPTTTICFSSTPSSSPVSIPPYISCDRSNFGAVASPSSETAPPHLKAGPILPGPPASTHLCTPGPPASTHLCTPGPPASTHLCTPVQKWEASAPSAPDQLADADPATLYAVVDGVPPSRWKELVRRLGLSEHEIERLELENGRHLREAQYSMLAAWRRRTPRREATLELLGRVLRDMDLLGCLENIEEALGGAARLASEPRLLW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TNFRSF1A |
Synonyms | TNFRSF1A; TNFR1; Tumor necrosis factor receptor superfamily member 1A; Tumor necrosis factor receptor 1; TNF-R1; Tumor necrosis factor receptor type I; TNF-RI; TNFR-I; p55; p60; CD antigen CD120a |
UniProt ID | O19131 |
◆ Recombinant Proteins | ||
Tnfrsf1a-6827M | Recombinant Mouse Tnfrsf1a Protein (Ile22-Ala212) | +Inquiry |
Tnfrsf1a-141M | Recombinant Mouse Tnfrsf1a Protein | +Inquiry |
TNFRSF1A-3190H | Active Recombinant Human TNFRSF1A Protein, His & Avi-tagged, Biotinylated | +Inquiry |
Tnfrsf1a-7049M | Recombinant Mouse Tnfrsf1a protein, His-tagged | +Inquiry |
Tnfrsf1a-314M | Recombinant Mouse TNFRSF1A Protein (ECD), Fc-His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF1A-1693MCL | Recombinant Mouse TNFRSF1A cell lysate | +Inquiry |
TNFRSF1A-1084RCL | Recombinant Rat TNFRSF1A cell lysate | +Inquiry |
TNFRSF1A-2390HCL | Recombinant Human TNFRSF1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF1A Products
Required fields are marked with *
My Review for All TNFRSF1A Products
Required fields are marked with *