Recombinant Full Length Bovine Vesicle Transport Protein Got1B(Golt1B) Protein, His-Tagged
Cat.No. : | RFL36881BF |
Product Overview : | Recombinant Full Length Bovine Vesicle transport protein GOT1B(GOLT1B) Protein (Q2YDE3) (1-138aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-138) |
Form : | Lyophilized powder |
AA Sequence : | MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFF QKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLN LPGIRSFVDKVGESNNMV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GOLT1B |
Synonyms | GOLT1B; Vesicle transport protein GOT1B; Golgi transport 1 homolog B |
UniProt ID | Q2YDE3 |
◆ Recombinant Proteins | ||
GOLT1B-7071M | Recombinant Mouse GOLT1B Protein | +Inquiry |
RFL17045HF | Recombinant Full Length Human Vesicle Transport Protein Got1B(Golt1B) Protein, His-Tagged | +Inquiry |
GOLT1B-3799M | Recombinant Mouse GOLT1B Protein, His (Fc)-Avi-tagged | +Inquiry |
GOLT1B-5461HF | Recombinant Full Length Human GOLT1B Protein, GST-tagged | +Inquiry |
GOLT1B-5117H | Recombinant Human GOLT1B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOLT1B-301HCL | Recombinant Human GOLT1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GOLT1B Products
Required fields are marked with *
My Review for All GOLT1B Products
Required fields are marked with *