Recombinant Full Length Human GOLT1B Protein, GST-tagged

Cat.No. : GOLT1B-5461HF
Product Overview : Human GOLT1B full-length ORF ( AAH12455.1, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 138 amino acids
Description : GOLT1B (Golgi Transport 1B) is a Protein Coding gene. GO annotations related to this gene include signal transducer activity and lipase activity. An important paralog of this gene is GOLT1A.
Molecular Mass : 40.92 kDa
AA Sequence : MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GOLT1B golgi transport 1B [ Homo sapiens (human) ]
Official Symbol GOLT1B
Synonyms GOLT1B; golgi transport 1B; GCT2; GOT1; GOT1B; CGI-141; YMR292W; vesicle transport protein GOT1B; germ cell tumor 2; hGOT1a; putative NF-kappa-B-activating protein 470
Gene ID 51026
mRNA Refseq NM_016072
Protein Refseq NP_057156
MIM 615078
UniProt ID Q9Y3E0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GOLT1B Products

Required fields are marked with *

My Review for All GOLT1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon