Recombinant Full Length Human GOLT1B Protein, GST-tagged

• Cat.No.: GOLT1B-5461HF
• Product Overview: Human GOLT1B full-length ORF ( AAH12455.1, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 138 amino acids
• Description: GOLT1B (Golgi Transport 1B) is a Protein Coding gene. GO annotations related to this gene include signal transducer activity and lipase activity. An important paralog of this gene is GOLT1A.
• Molecular Mass: 40.92 kDa
• AA Sequence: MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GOLT1B golgi transport 1B [ Homo sapiens (human) ]
• Official Symbol: GOLT1B
• Synonyms: GOLT1B; golgi transport 1B; GCT2; GOT1; GOT1B; CGI-141; YMR292W; vesicle transport protein GOT1B; germ cell tumor 2; hGOT1a; putative NF-kappa-B-activating protein 470
• Gene ID: 51026
• mRNA Refseq: NM_016072
• Protein Refseq: NP_057156
• MIM: 615078
• UniProt ID: Q9Y3E0