Recombinant Full length Canine interferon gamma Protein, Tag Free
Cat.No. : | IFNG-33CFL |
Product Overview : | The Canine IFN gamma recombinant protein was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Canine |
Source : | Yeast |
Tag : | Non |
Protein Length : | 1-166aa |
Description : | Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. This interferon was originally called macrophage-activating factor, a term now used to describe a larger family of proteins to which IFN-gamma belongs. IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFN-gamma expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFN-gamma in the immune system stems in part from its ability to inhibit viral replication directly, but, most important, derives from its immunostimulatory and immunomodulatory effects. IFN-gamma is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops. |
Tag : | Non |
Molecular Mass : | 16.7 kDa |
AA Sequence : | QAMFFKEIENLKEYFNASNPDVSDGGSLFVDILKKWREESDKTIIQSQIVSFYLKLFDNFKDNQIIQRSMDTIKEDMLGKFLNSSTSKREDFLKLIQIPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK(143) |
Applications : | The Canine IFN gamma endotoxin-free recombinant protein can be used in cell culture, as an IFN gamma ELISA Standard, and as a Western Blot Control. |
References : | 1. TNF-α and INF-γ primed canine stem cell-derived extracellular vesicles alleviate experimental murine colitis. An JH, Li Q, Bhang DH, Song WJ, Youn HY. Sci Rep. 2020 Feb 7;10(1):2115. doi: 10.1038/s41598-020-58909-4. |
Gene Name | IFNG interferon gamma [ Canis lupus familiaris (dog) ] |
Official Symbol | IFNG |
Synonyms | IFNG; interferon gamma; IFN-G; IFN-gamma |
Gene ID | 403801 |
mRNA Refseq | NM_001003174 |
Protein Refseq | NP_001003174 |
UniProt ID | P42161 |
◆ Recombinant Proteins | ||
IFNG-6015H | Active Recombinant Human IFNG protein | +Inquiry |
IFNG-5433S | Recombinant Sheep IFNG protein, His-tagged | +Inquiry |
IFNG-264I | Active Recombinant Human IFNG Protein | +Inquiry |
IFNG-33CFL | Recombinant Full length Canine interferon gamma Protein, Tag Free | +Inquiry |
Ifng-510M | Active Recombinant Mouse Ifng protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
0
Inquiry Basket