Recombinant Full length Canine interferon gamma Protein, Tag Free

Cat.No. : IFNG-33CFL
Product Overview : The Canine IFN gamma recombinant protein was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Canine
Source : Yeast
Tag : Non
Protein Length : 1-166aa
Description : Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. This interferon was originally called macrophage-activating factor, a term now used to describe a larger family of proteins to which IFN-gamma belongs. IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFN-gamma expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFN-gamma in the immune system stems in part from its ability to inhibit viral replication directly, but, most important, derives from its immunostimulatory and immunomodulatory effects. IFN-gamma is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops.
Tag : Non
Molecular Mass : 16.7 kDa
AA Sequence : QAMFFKEIENLKEYFNASNPDVSDGGSLFVDILKKWREESDKTIIQSQIVSFYLKLFDNFKDNQIIQRSMDTIKEDMLGKFLNSSTSKREDFLKLIQIPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK(143)
Applications : The Canine IFN gamma endotoxin-free recombinant protein can be used in cell culture, as an IFN gamma ELISA Standard, and as a Western Blot Control.
References : 1. TNF-α and INF-γ primed canine stem cell-derived extracellular vesicles alleviate experimental murine colitis. An JH, Li Q, Bhang DH, Song WJ, Youn HY. Sci Rep. 2020 Feb 7;10(1):2115. doi: 10.1038/s41598-020-58909-4.
Gene Name IFNG interferon gamma [ Canis lupus familiaris (dog) ]
Official Symbol IFNG
Synonyms IFNG; interferon gamma; IFN-G; IFN-gamma
Gene ID 403801
mRNA Refseq NM_001003174
Protein Refseq NP_001003174
UniProt ID P42161

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNG Products

Required fields are marked with *

My Review for All IFNG Products

Required fields are marked with *

0
cart-icon
0
compare icon