| Species : |
Canine |
| Source : |
Yeast |
| Tag : |
Non |
| Protein Length : |
1-166aa |
| Description : |
Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. This interferon was originally called macrophage-activating factor, a term now used to describe a larger family of proteins to which IFN-gamma belongs. IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFN-gamma expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFN-gamma in the immune system stems in part from its ability to inhibit viral replication directly, but, most important, derives from its immunostimulatory and immunomodulatory effects. IFN-gamma is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops. |
| Tag : |
Non |
| Molecular Mass : |
16.7 kDa |
| AA Sequence : |
QAMFFKEIENLKEYFNASNPDVSDGGSLFVDILKKWREESDKTIIQSQIVSFYLKLFDNFKDNQIIQRSMDTIKEDMLGKFLNSSTSKREDFLKLIQIPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK(143) |
| Applications : |
The Canine IFN gamma endotoxin-free recombinant protein can be used in cell culture, as an IFN gamma ELISA Standard, and as a Western Blot Control. |
| References : |
1. TNF-α and INF-γ primed canine stem cell-derived extracellular vesicles alleviate experimental murine colitis. An JH, Li Q, Bhang DH, Song WJ, Youn HY. Sci Rep. 2020 Feb 7;10(1):2115. doi: 10.1038/s41598-020-58909-4. |
