Recombinant Full Length Carassius Auratus Neuronal Acetylcholine Receptor Subunit Beta-2(Chrnb2) Protein, His-Tagged
Cat.No. : | RFL22011CF |
Product Overview : | Recombinant Full Length Carassius auratus Neuronal acetylcholine receptor subunit beta-2(chrnb2) Protein (P19370) (1-459aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Carassius auratus (Goldfish) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-459) |
Form : | Lyophilized powder |
AA Sequence : | LRSDFLLGPERYNKLIRPAVNKSQQVTIGIKVSLAQLISVNEREQIMTTNVWLTQEWTDY RLVWDPNEYEGIKKLRIPSQHIWLPDIVLYNNADGVYEVSFYCNAVVSNTGDIFWLPPAI YKSACAIEVRNFPFDQQNCTLKFRSWTYDRTELDLVLTSDFASRDDYTPSGEWDIVSLPG RKNEDPNDLTYLDITYDFVIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKVTLCM SVLLALTVFLLLISKIVPPTSLAVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHY MPEWVKCVFLHKLPAFLLMRRPGRSNVRERFRRKHQRKSFSSHQDGDSFFLTDDPGRVCG AWRVGDLPEGSEFRQRVKVRHDQDVDEAIDGVRFIAEHMKIEDDDEGIIEDWKYVAMVID RLFLWIFILVCVVGTLGLFVQPLFQSYNTPVAEEVYGDF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | chrnb2 |
Synonyms | chrnb2; Neuronal acetylcholine receptor subunit beta-2; GF-beta-2; Fragment |
UniProt ID | P19370 |
◆ Recombinant Proteins | ||
CHRNB2-1286H | Recombinant Human CHRNB2 Protein, GST-Tagged | +Inquiry |
CHRNB2-690R | Recombinant Rhesus Macaque CHRNB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNB2-1727H | Recombinant Human CHRNB2 Protein (Trp24-Pro244), N-His tagged | +Inquiry |
CHRNB2-11217H | Recombinant Human CHRNB2, His-tagged | +Inquiry |
CHRNB2-864R | Recombinant Rhesus monkey CHRNB2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNB2-7512HCL | Recombinant Human CHRNB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All chrnb2 Products
Required fields are marked with *
My Review for All chrnb2 Products
Required fields are marked with *
0
Inquiry Basket